Compuestos y reactivos bioquímicos
Los bioquímicos y reactivos son sustancias fundamentales para la investigación y el desarrollo en campos como la biotecnología, la biología molecular, la farmacología y la medicina. Estos productos son esenciales para una variedad de aplicaciones, incluyendo la síntesis de compuestos, el análisis de muestras biológicas, la investigación de procesos metabólicos y la producción de medicamentos. En CymitQuimica, ofrecemos una amplia selección de bioquímicos y reactivos de alta calidad y pureza, adecuados para diversas necesidades científicas e industriales. Nuestro catálogo incluye enzimas, anticuerpos, ácidos nucleicos, aminoácidos, y muchos otros productos, todos diseñados para apoyar a los investigadores y profesionales en sus proyectos de investigación y desarrollo, asegurando resultados confiables y reproducibles.
Subcategorías de "Compuestos y reactivos bioquímicos"
- Biomoléculas(99.104 productos)
- Por objetivo biológico(99.074 productos)
- Según efectos farmacológicos(6.784 productos)
- Crioconservantes(21 productos)
- Desinfectantes y compuestos relacionados(28 productos)
- Hormonas(346 productos)
- Biología Vegetal(6.693 productos)
- Metabolitos secundarios(14.218 productos)
Se han encontrado 130576 productos de "Compuestos y reactivos bioquímicos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Rat Estradiol ELISA kit
<p>ELISA Kit for detection of Estradiol in the research laboratory</p>Pureza:Min. 95%Dequalinium chloride hydrate
CAS:<p>Dequalinium chloride hydrate is a molecule that is used to treat various types of cancer, such as breast, lung, and prostate cancers. It inhibits HDACs and has been shown to induce apoptosis in a number of cancer cell lines. The drug also prevents the accumulation of damaged DNA and reduces drug sensitivity, leading to increased survival rates in mice with cancer. Dequalinium chloride hydrate has been shown to inhibit mitochondrial membrane potential in muscle tissue, leading to apoptosis and necrosis. This drug may have some potential for use in treating cardiac conditions such as heart failure.</p>Fórmula:C30H40N4•Cl2•(H2O)xPureza:Min. 95%Forma y color:PowderPeso molecular:545.6 g/molRef: 3D-FAC07734
Producto descatalogadoMelanocyte Protein PMEL 17 (256-264) (human, bovine, mouse)
<p>Custom research peptide; min purity 95%.</p>Fórmula:C44H67N9O14Pureza:Min. 95%Peso molecular:946.08 g/molRef: 3D-PM17049
Producto descatalogadoMouse BDNF ELISA Kit
<p>ELISA kit for detection of BDNF in the research laboratory</p>Pureza:Min. 95%Rheumatoid Factor IgA ELISA kit
<p>ELISA kit for the detection of Rheumatoid Factor IgA in the research laboratory</p>Pureza:Min. 95%HO1, gst tagged human
CAS:<p>The enzyme HO1, also known as heme oxygenase 1, is a member of the heme oxygenase family. It is an enzyme that catalyzes the oxidation of heme to produce biliverdin and free iron. HO1 is also a receptor for nitric oxide, which can lead to changes in downstream signaling pathways. The recombinant human HO1 protein has been tagged with GST at its C-terminus and purified by affinity chromatography. This product is suitable for use in research tools, cell biology, ion channels, and other applications where HO1 is used as a reagent or control.</p>Pureza:Min. 95%PDGFB antibody
<p>PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD</p>Pureza:Min. 95%Mouse Laminin ELISA Kit
<p>ELISA kit for detection of Laminin in the research laboratory</p>Pureza:Min. 95%5HIAA ELISA Kit
<p>5HIAA ELISA Kit for the quantitative determination of 5HIAA in urine</p>Pureza:Min. 95%Mouse Isotyping Kit
<p>Mouse Antibody Isotype Kit is a single-use, lateral flow-based test that in 5 minutes can identify mouse monoclonal antibody class and subclass.Reliable - Comparable results to ELISA assays.Fast - 5 minutes from start to finish.Convenient - Only requires 2 steps - dilute sample and load sample.Inexpensive - No equipment or additional reagents required.Specific - No Reactivity with Fetal Bovine Serum.</p>Pureza:Min. 95%Rat PDGFAB ELISA Kit
<p>ELISA Kit for detection of PDGFAB in the research laboratory</p>Pureza:Min. 95%Rat MIP3 α ELISA Kit
<p>ELISA Kit for detection of MIP3 alpha in the research laboratory</p>Pureza:Min. 95%Rheumatoid Factor IgG ELISA Kit
<p>ELISA kit for detection of Rheumatoid Factor IgG in the research laboratory</p>Pureza:Min. 95%Ferumoxytol
CAS:<p>Ferumoxytol is used in magnetic resonance imaging (MRI) to improve the quality of images. It is given intravenously and is excreted unchanged by the kidneys. Ferumoxytol has been shown to be safe and effective for diagnosing bowel disease, including Crohn's disease, ulcerative colitis, and diverticulitis. Ferumoxytol also has been shown to be useful in evaluating cardiac function before and after myocardial infarction. Ferumoxytol has a low toxicity profile with no significant adverse effects reported during clinical trials.</p>Fórmula:Fe3H2O4Pureza:Min. 95%Peso molecular:233.55 g/molParvovirus IgG ELISA kit
<p>ELISA kit for the detection of Parvovirus IgG in the research laboratory</p>Pureza:Min. 95%
