Compuestos y reactivos bioquímicos

<p>Rat Hemopexin ELISA Kit</p>

<p>Rat Plasminogen ELISA Kit</p>

<p>ELISA kit for the detection of ENA in the research laboratory</p>

<p>Calibrator for Chicken ELISA Kit</p>

<p>HEMISODIUM® HEPES is a buffered solution of sodium salt of HEPES, a buffer with the pH between 7.4 and 8.0, prepared from an aqueous solution of disodium hydrogen phosphate and sodium hydroxide. This buffer is used in biochemical research for its ability to inhibit voltage-dependent calcium channels and induce cell lysis. It also has antimicrobial properties that can be used as treatment for bacterial infections. HEMISODIUM® HEPES has been shown to be effective against some strains of methicillin-resistant Staphylococcus aureus (MRSA) and Mycobacterium tuberculosis in vitro.</p>

<p>ELISA Kit for detection of PDGFAB in the research laboratory</p>

<p>Mouse Antibody Isotype Kit is a single-use, lateral flow-based test that in 5 minutes can identify mouse monoclonal antibody class and subclass.Reliable - Comparable results to ELISA assays.Fast - 5 minutes from start to finish.Convenient - Only requires 2 steps - dilute sample and load sample.Inexpensive - No equipment or additional reagents required.Specific - No Reactivity with Fetal Bovine Serum.</p>

<p>ELISA kit for detection of BDNF in the research laboratory</p>

<p>ELISA kit for detection of Laminin in the research laboratory</p>

<p>GPR116 antibody was raised in Rabbit using Human GPR116 as the immunogen</p>

<p>ELISA kit for the detection of NGAL in the research laboratory</p>

<p>Rat KIM-1 ELISA Kit</p>

<p>Purified Cat/Feline Haptoglobin</p>

<p>Borrelia burgdorferi (Lyme disease) OspA Protein is a highly purified HIS tagged recombinant protein that is derived from E.coli.</p>

<p>ELISA kit for detection of Laminin in the research laboratory</p>

<p>Mouse Fibronectin ELISA Kit</p>

<p>ELISA Kit for detection of AVP in the research laboratory</p>

<p>Ferumoxytol is used in magnetic resonance imaging (MRI) to improve the quality of images. It is given intravenously and is excreted unchanged by the kidneys. Ferumoxytol has been shown to be safe and effective for diagnosing bowel disease, including Crohn's disease, ulcerative colitis, and diverticulitis. Ferumoxytol also has been shown to be useful in evaluating cardiac function before and after myocardial infarction. Ferumoxytol has a low toxicity profile with no significant adverse effects reported during clinical trials.</p>

<p>Cysteine peptide (Ac RFAAKAA COOH) is used in combination with Lysinepeptide (Ac RFAACAA COOH) in the Direct Peptide Reactivity Assay (DPRA) test.<br>Direct Peptide Reactivity Assay is used in cosmetic applications for the characterization of the skin sensitizing potential of a substance, framed by OECD Guideline no 442.<br>The molecular initiating event (MIE) in skin sensitization is a binding between epidermal proteins and the sensitizing chemical substance. MIE is part of the adverse outcome pathway (AOP) of skin sensitization.<br>It is thanks to the properties of Lysine peptide and Cysteine peptide that the chemical binding will be able to take place, so these synthetic heptapeptides will mimic the reaction of a skin exposed to a substance.<br>Binding between nucleophilic proteins and electrophile substance will be measured by High Performance Liquid Chromatography (HPLC). Therefore, the decrease in Lysine peptide and Cysteine peptide levels will be a sign of sensitizing event. Depending on the rate of depletion, the sensitizing character of a molecule will be determined (see table at the bottom of the page).<br>In chemico DPRA test also has wider applications such as hazard classification in cosmetics, but also for pharmaceuticals and biocides. It is a good alternative to animal experimentation.</p>

<p>Please enquire for more information about Dog IgM ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for detection of Cystatin C in the research laboratory</p>

<p>Please enquire for more information about Rat A2M ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for the detection of ANCA combi in the research laboratory</p>

<p>Please enquire for more information about CHO NUCB2 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Horse Haptoglobin ELISA Kit</p>

<p>The Monkey IgM ELISA kit is intended for the quantitative determination of total monkey IgM (new and old world) in biological samples.</p>

<p>Dequalinium chloride hydrate is a molecule that is used to treat various types of cancer, such as breast, lung, and prostate cancers. It inhibits HDACs and has been shown to induce apoptosis in a number of cancer cell lines. The drug also prevents the accumulation of damaged DNA and reduces drug sensitivity, leading to increased survival rates in mice with cancer. Dequalinium chloride hydrate has been shown to inhibit mitochondrial membrane potential in muscle tissue, leading to apoptosis and necrosis. This drug may have some potential for use in treating cardiac conditions such as heart failure.</p>

<p>ELISA Kit for detection of VEGFR2 in the research laboratory</p>

<p>Please enquire for more information about Human Lactoferrin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Horse IgM ELISA Kit</p>

<p>SLV-2436 is a highly specialized laboratory reagent, which is synthetically derived through an advanced chemical process with rigorous quality control. Its mode of action involves precise interactions at a molecular level, facilitating targeted reactions and transformations essential for a variety of analytical and research applications.</p>

<p>Goat polyclonal Human Ceruloplasmin antibody</p>

<p>Please enquire for more information about Human IgE ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Dog IgA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Chicken SAA ELISA Kit - For the quantitative determination of serum amyloid A (SAA) in chicken samples.</p>

<p>Canine/Dog SAA ELISA Kit - For the quantitative determination of serum amyloid A (SAA) in dog samples.</p>

<p>Horse SAA ELISA Kit</p>

<p>Bovine SAA ELISA Kit</p>

<p>Please enquire for more information about Hamster (CHO) GTP-binding Nuclear Protein (RAN) ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Interleukin 6 (IL-6) is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha.</p>

<p>Recombinant SARS-CoV-2 Nucleocapsid Protein (GenBank# QHD43423.2, a.a.1-419) with a 6xHIS tag was expressed in E. coli and purified by nickel affinity chromatography.</p>

<p>Hamster (CHO) Glutathione S Transferase Pi (GSTp) ELISA Kit<br>Glutathione S-transferase Pi (GSTp) is a metabolic enzyme that facilitates metabolite detoxification and antioxidation. GSTp reduces efficacy of chemotherapy drugs and inhibits tumor-cell apoptosis.</p>

<p>Please enquire for more information about Human Myeloperoxidase (MPO) ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Purified recombinant protein from a sequence within the PEDV Spike Protein (S1) domain. Expressed and purified from CHO cells and contains a 6xHIS tag.</p>

<p>Recombinant SARS-CoV-2 Spike S1 Receptor Binding Domain (RBD; GenBank QHD43416.1, a.a.318-541) with a 6xHIS tag was expressed in HEK293 cells and purified by nickel affinity chromatography. Under SDS-PAGE reducing conditions, the protein is detected at an estimated molecular weight of ~35 kDa. Optimal working dilutions should be determined experimentally by the investigator.</p>

<p>Leptin is a cell-signalling hormone vital in the regulation of appetite, food intake and body weight. Studies have shown that an absence of leptin in the body or leptin resistance can lead to uncontrolled feeding and weight gain. Because obesity is an established risk factor in various cancers and leptin plays a significant role in the physiopathology of obesity, the exploration of leptin's link to cancer risk is of considerable importance.</p>

<p>Cat SAA ELISA Kit - For the quantitative determination of serum amyloid A (SAA) in feline samples.</p>

<p>Please enquire for more information about Mouse Fibrinogen ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ready to use Mouse C1q ELISA Kit</p>

<p>Bovine/Cow CRP ELISA Kit - For the quantitative determination of c-reactive protein (CRP) in cow/bovine samples.</p>

<p>Rat Antithrombin III ELISA Kit</p>

<p>ELISA Kit for detection of MMP1 in the research laboratory</p>

<p>ELISA kit for the detection of GBM in the research laboratory</p>

<p>Hamster (CHO) Phospholipase B-Like 2 (PLBL2) ELISA Kit</p>

<p>Human sequence expressed in CHO Cells; purity &gt;95% by SDS-PAGE and analyzed by silver stain; Fc Fusion Protein.</p>

<p>Pig Plasminogen ELISA Kit</p>

<p>Custom research peptide; min purity 95%.</p>

<p>ELISA kit for the detection of SSA  in the research laboratory</p>

<p>ELISA kit for the detection of Chlamydia pneumoniae IgG in the research laboratory</p>

<p>ELISA kit for the detection of dsDNA IgA in the research laboratory</p>

<p>ELISA kit for the detection of MicroAlbumin in the research laboratory</p>

<p>Dog Transferrin ELISA Kit</p>

<p>SNIPER(ABL)-058 is a cutting-edge selective protein degrader, developed from the field of chemical biology. It is based on a bifunctional small molecule that acts as a degrader by recruiting the ubiquitin-proteasome system to specifically tag the target protein for degradation. This compound is synthesized through precise chemical modifications designed to form specific interactions with its target, namely the BCR-ABL protein, a critical driver in certain cancer pathways.</p>

<p>ELISA kit for the detection of IGFBP1 in the research laboratory</p>

<p>ELISA kit for detection of EGFR in the research laboratory</p>

<p>ELISA Kit for detection of Free Triiodothyronine in the research laboratory</p>

<p>Human Novel Coronavirus Nucleoprotein (SARS-CoV-2 N) IgG Ab ELISA Kit</p>

<p>Thymus peptide C is a peptide that is an inhibitor of Protein interactions. It binds to the receptor and activates the Ligand, which then inhibits ion channels. Thymus peptide C has been used as a research tool to study the inhibition of ion channels in cells. This peptide has also been used as an antibody for the detection of antigens that are associated with cell proliferation.</p>

<p>Mouse Transferrin ELISA Kit</p>

<p>Ovotransferrin is an acute-phase protein with iron-binding and immunomodulatory functions.</p>

<p>AMC is a peptide that acts as an activator of the nicotinic acetylcholine receptor. AMC is a high-purity, ion channel ligand with a CAS No. 26093-31-2. It is used in life science research to study cell biology and pharmacology. AMC has been shown to be an inhibitor of the enzyme acetylcholinesterase (AChE) in rat brain slices and it has been reported that it can inhibit the proliferation of human leukemia cells.END&gt;</p>

<p>Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SYNCRIP antibody, catalog no. 70R-1335</p>

<p>Please enquire for more information about 1,9-Dichloro-3,7-diazanonane dihydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Chicken Alpha 1-Acid Glycoprotein ELISA Kit</p>

<p>Mouse Plasminogen ELISA Kit</p>

<p>Please enquire for more information about 3,7,11,15,19,23,27,31,35-nonamethyl-2E,6E,10E,34-hexatriacontatetraene-1,15,19,23,27,31-hexol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Horse CRP ELISA Kit</p>

<p>Tosedostat-d5 is an analog of Tosedostat, an anticancer drug that inhibits the activity of a variety of kinases involved in cancer cell growth and survival. This compound has been shown to induce apoptosis in human cancer cells and has demonstrated promising results in preclinical studies. Tosedostat-d5 is labeled with five deuterium atoms, which makes it useful as a tracer for pharmacokinetic and metabolic studies. It is also used as a tool for investigating the metabolism of other drugs, such as rifampicin and astaxanthin, in Chinese hamster ovary cells. Inhibitors of tosedostat-d5 have been developed for use in cancer therapy, making this compound an important tool for research into new anticancer treatments.</p>

<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein (PE)</p>

<p>Please enquire for more information about Rat Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Rituximab is a chimeric monoclonal antibody used in the treatment of some cancers like CD20 non-Hodgkin's lymphoma and a few autoimmune conditions such as rheumatoid arthritis. However, antibody treatment can lead to generation of neutralising antibodies thus curtailing the efficacy of the therapy. CD 4+ T cells are critical to initiate antibody response so identification of epitopes within molecules using T cell assays can be a vital tool for understanding the immune response and thereby prevent induction of neutralising antibodies. Within rituximab, the variable region of the light chain (41-55) was found to have strong affinity for leukocytes in a specific binding assay, the epitope was also correlated to patients who developed neutralising antibodies. This T cell epitope within rituximab in further immune studies could help design or selection of antibodies without T cell epitopes present for low immunogenicity.</p>

<p>C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.<br>High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.</p>

<p>ELISA kit for detection of Laminin in the research laboratory</p>

<p>Bovine/Cow AGP ELISA Kit</p>

<p>ELISA kit for the detection of Gliadin IgA in the research laboratory</p>

<p>Affinity purified Rabbit polyclonal XPR1 antibody</p>

<p>ELISA Kit for detection of MMP3 in the research laboratory</p>

<p>ELISA kit for the detection of TRAIL in the research laboratory</p>

<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein (FITC)</p>

<p>ELISA Kit for detection of IgG in the research laboratory</p>

<p>ELISA kit for the detection of Cystatin C in the research laboratory</p>

<p>ELISA Kit for detection of MMP1 in the research laboratory</p>

<p>ELISA Kit for detection of Free Thyroxine in the research laboratory</p>

<p>ELISA kit for the detection of Human VEGF in the research laboratory</p>

<p>ELISA kit for the detection of Rat/Mouse Corticosterone in the research laboratory</p>

<p>LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK</p>

<p>ELISA kit for the detection of Annexin V in the research laboratory</p>

<p>ELISA kit for detection of MIF in the research laboratory</p>

<p>ELISA Kit for detection of IL12 (p70) in the research laboratory</p>

<p>ELISA Kit for detection of Mouse Coagulation Factor III in the research laboratory</p>

<p>ELISA kit for detection of Progesterone in the research laboratory</p>

<p>H, K ATPase antibody was raised in mouse using a 34kDa core peptide purified from deglycosylated hog gastric microsomes as the immunogen.</p>

<p>ELISA Kit for detection of TGFB1 in the research laboratory</p>

<p>ELISA Kit for detection of IFNb in the research laboratory</p>

<p>GTF2H1 antibody was raised in Rabbit using Human GTF2H1 as the immunogen</p>

<p>ELISA Kit for detection of von Willebrand Factor in the research laboratory</p>

<p>Influenza A Calibration Kit for the production of Influenza A Nucleoprotein calibration curve</p>

<p>ELISA Kit for detection of IL16 in the research laboratory</p>

<p>ELISA kit for the detection of Triiodothyronine Uptake in the research laboratory</p>

<p>Salivary sample collection kit for the detection of free Salivary proteins and enzymes in the research laboratory</p>

<p>ELISA kit for the detection of Human HGF in the research laboratory</p>

<p>ELISA Kit for detection of HCG in the research laboratory</p>

<p>VMAT2 antibody was raised in rabbit using a synthetic peptide from C-terminus of rat VMAT2 conjugated to BSA as the immunogen.</p>

<p>ELISA Kit for detection of IgA in the research laboratory</p>

<p>ELISA kit for the detection of EPO in the research laboratory</p>

<p>ELISA kit for the detection of IL1 alpha in the research laboratory</p>

<p>ELISA kit for the detection of Gliadin screen in the research laboratory</p>

<p>ELISA Kit for detection of Thyroxine in the research laboratory</p>

<p>ELISA kit for the detection of Prothrombin IgG/IgM in the research laboratory</p>

<p>ELISA Kit for detection of IgA in the research laboratory</p>

<p>ELISA kit for the detection of Parietal Cell in the research laboratory</p>

<p>Biotin labeling kit for IgG</p>

<p>ELISA Kit for detection of PPARa in the research laboratory</p>

<p>Adrenaline/Noradrenaline ELISA Kit for the rapid quantitative determination of Adrenaline/Noradrenaline in plasma</p>

<p>ELISA kit for detection of Dihydrotestosterone in the research laboratory</p>

<p>ELISA kit for the detection of Leptin Receptor in the research laboratory</p>

<p>ELISA Kit for detection of PGF2a in the research laboratory</p>

<p>ELISA Kit for detection of Prolactin in the research laboratory</p>

<p>ELISA kit for the detection of Thyroglobulin in the research laboratory</p>

<p>Human NGAL ELISA Kit</p>

<p>C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.<br>High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.</p>

<p>Human KIM-1 ELISA Kit</p>

<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>

<p>Bovine IL-6 ELISA Kit</p>

<p>Please enquire for more information about Human SAA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL</p>

<p>For the quantitative determination of Human leucine-rich alpha-2 glycoprotein 1 (LRG1) in biological samples.</p>

<p>Insulin is a peptide hormone that is produced by beta cells in the pancreas. Insulin has several important functions, including regulation of blood sugar levels, lipid metabolism and protein synthesis. It is also involved in the regulation of cellular growth and proliferation. Insulin binds to insulin receptors on the surface of cells, activating them and allowing for the uptake of glucose into cells and storage as glycogen. Insulin is a ligand for the insulin receptor. It can also bind to other receptors, such as IGF1R, which causes activation of PI3K/AKT pathway. Insulin is an antibody that can be used as research tool or cell biology reagent.<br>INSULIN CAN BE USED TO:<br>- Measure blood sugar levels<br>- Monitor diabetes<br>- Treat diabetes<br>- Control weight gain<br>- Improve muscle mass</p>

<p>The Guinea Pig IgG ELISA kit is intended for the quantitative determination of total guinea pig IgG in biological samples.</p>

<p>Sodium pyrophosphate decanhydrate is a methyltransferase inhibitor that blocks the enzyme form of the DNA methyltransferase, which is responsible for maintaining DNA methylation patterns. It has been shown to inhibit the enzymatic activity of this enzyme in a model system. Sodium pyrophosphate decanhydrate inhibits the growth of bacteria by binding to water molecules and preventing them from binding to other molecules, causing dehydration. This drug also has potential as a natriuretic peptide levels inhibitor, with electrochemical impedance spectroscopy studies showing that it may have a high affinity for sodium ions. Studies have also shown that sodium pyrophosphate decanhydrate has no toxicity in mice.</p>

<p>Please enquire for more information about Mouse SAP ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Human Beta 2-Microglobulin ELISA Kit<br>Beta 2-Microglobulin is a component of the major histocompatibility complex involving the presentation of peptide antigens to the immune system.</p>

<p>Please enquire for more information about Human Prealbumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Human Alpha 1-Antitrypsin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Rat IgM ELISA Kit</p>

<p>Mouse Cystatin C ELISA Kit</p>

<p>Mots-C is a mitochondrial-derived peptide, which is encoded by the small open reading frame found within the mitochondrial 12S rRNA. This peptide functions by interacting with the cellular metabolic pathways to enhance mitochondrial bioenergetics and overall cellular metabolism. Mechanistically, Mots-C modulates the folate–methionine cycle, directly impacting glucose regulation and energy utilization, and consequently facilitating cellular adaptation to metabolic stress.</p>

<p>Please enquire for more information about Rat Hemoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The Sheep IgG ELISA kit is intended for the quantitative determination of total sheep IgG in biological samples.</p>

<p>Mouse Fetuin/AHSG ELISA Kit.</p>

<p>Human IgD ELISA Kit</p>

<p>Inhibitor of p38 MAPK kinase</p>

<p>Please enquire for more information about Mouse KIM-1 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Pig Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Rabbit IgG ELISA Kit - For the quantitative determination of total IgG in biological samples.</p>

<p>Please enquire for more information about Rat Albumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for the detection of Phospholipid Screen IgG/IgM in the research laboratory</p>

<p>Mouse monoclonal TPMT antibody</p>

<p>Pig IgA ELISA Kit</p>

<p>Human Osteopontin ELISA is intended for the quantitative determination of human osteopontin in biological samples.</p>

<p>Cip1 antibody was raised in rabbit using residues 139-164 of the p21 protein as the immunogen.</p>

<p>ELISA kit for the detection of IL1 beta in the research laboratory</p>

<p>Hamster (CHO) Clusterin ELISA Kit<br>Clusterin plays key roles in protein homeostasis/proteostasis, and the modulation of pro-survival signaling networks.</p>

<p>Chicken IgA ELISA Kit</p>

<p>ELISA kit for the detection of Mouse IL2 in the research laboratory</p>

<p>ELISA kit for the detection of CA 199 in the research laboratory</p>

<p>ELISA kit for the detection of Human VEGF in the research laboratory</p>

<p>H-His-Arg-OH is a synthetic peptide that has been shown to have cytotoxic effects on mammalian cells. The H-His-Arg-OH peptide can be used for the treatment of heart disease and autoimmune diseases, such as rheumatoid arthritis. This peptide has been found to be resistant to congestive heart failure, which is caused by a number of factors, including hypertension and valvular stenosis. It has also been shown to have an immunoglobulin G1 (IgG1) genotype.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Amyloid beta-Protein (36-38) is a peptide that has molecular weight of 4.3 kDa. It is a fragment of amyloid precursor protein, which is cleaved by enzymes in the brain to create the peptide. Amyloid beta-Protein (36-38) has been found to be involved in Alzheimer's disease as it aggregates into β-sheet bundles and forms amyloid plaques in the brain. This protein can be detected using vibrational spectroscopy and has been observed to have a strain that changes depending on pH. This molecule also undergoes proteolysis by peptidases, which break down proteins into amino acids for analysis with an amino acid analyzer. The solute can be analyzed with an acid analysis or spectrometer, which are used to determine functional groups such as carboxylic acids, hydroxyls, or amides. Amyloid beta-Protein (36-38)</p>

<p>05:0 PC is a peptide binding sequence that has been shown to inhibit the replication of viral sequences. 05:0 PC binds to the amino acid sequence in protein, which is a model system for peptide binding. The endoplasmic reticulum, or ER, is the site of synthesis for proteins and its low efficiency may be due to the spontaneous nature of the protein synthesis process. The ER can also be seen as an inhibitor molecule that prevents the virus from replicating. 05:0 PC has been shown to inhibit papillomavirus and HIV-1 replication in vitro. This peptide has also been shown to block interactions between viruses and cells that allow viral replication.</p>