Compuestos y reactivos bioquímicos
Los bioquímicos y reactivos son sustancias fundamentales para la investigación y el desarrollo en campos como la biotecnología, la biología molecular, la farmacología y la medicina. Estos productos son esenciales para una variedad de aplicaciones, incluyendo la síntesis de compuestos, el análisis de muestras biológicas, la investigación de procesos metabólicos y la producción de medicamentos. En CymitQuimica, ofrecemos una amplia selección de bioquímicos y reactivos de alta calidad y pureza, adecuados para diversas necesidades científicas e industriales. Nuestro catálogo incluye enzimas, anticuerpos, ácidos nucleicos, aminoácidos, y muchos otros productos, todos diseñados para apoyar a los investigadores y profesionales en sus proyectos de investigación y desarrollo, asegurando resultados confiables y reproducibles.
Subcategorías de "Compuestos y reactivos bioquímicos"
- Biomoléculas(99.115 productos)
- Por objetivo biológico(99.160 productos)
- Según efectos farmacológicos(6.787 productos)
- Crioconservantes(21 productos)
- Desinfectantes y compuestos relacionados(28 productos)
- Hormonas(346 productos)
- Biología Vegetal(6.722 productos)
- Metabolitos secundarios(14.222 productos)
Se han encontrado 130582 productos de "Compuestos y reactivos bioquímicos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Human Hemopexin ELISA Kit
<p>Please enquire for more information about Human Hemopexin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Rat Albumin ELISA Kit
<p>Please enquire for more information about Rat Albumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Pig Haptoglobin ELISA Kit
<p>Please enquire for more information about Pig Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Dog IgE ELISA Kit
<p>Please enquire for more information about Dog IgE ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Affinity Purified anti-Human Ferritin Antibody
<p>Affinity Purified Rabbit anti-Human Ferritin Antibody</p>Pureza:Min. 95%Mouse Haptoglobin ELISA Kit
<p>Please enquire for more information about Mouse Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Chicken IgY ELISA Kit
<p>IgY, or immunoglobulin Y, is a type of antibody found in the immune systems of birds, reptiles, and amphibians. It serves a similar function to IgG in mammals. In birds, IgY is the primary antibody found in serum, egg yolk, and other bodily fluids, whereas in mammals, IgG is the predominant antibody. IgY antibodies are important for providing passive immunity to offspring through the transfer of antibodies from the mother to the egg yolk, similar to how mammals transfer antibodies through the placenta or breast milk. IgY antibodies have also been used in research and diagnostic applications due to their specificity and ability to be harvested from egg yolks.</p>Pureza:Min. 95%Human Prealbumin ELISA Kit
<p>Please enquire for more information about Human Prealbumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Rat Clusterin ELISA Kit
<p>Rat Clusterin ELISA Kit<br>Clusterin plays key roles in protein homeostasis/proteostasis, and the modulation of pro-survival signaling networks.</p>Pureza:Min. 95%Human A2M ELISA Kit
<p>Please enquire for more information about Human A2M ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Dog CRP ELISA Kit
<p>C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.<br>High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.</p>Pureza:Min. 95%Human Osteopontin ELISA Kit
<p>Human Osteopontin ELISA is intended for the quantitative determination of human osteopontin in biological samples.</p>Pureza:Min. 95%Mouse Retinol Binding Protein ELISA Kit
<p>Mouse Retinol Binding Protein ELISA Kit</p>Pureza:Min. 95%Human Apolipoprotein A1 ELISA Kit
<p>Please enquire for more information about Human Apolipoprotein A1 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Rat CRP ELISA Kit
<p>Please enquire for more information about Rat CRP ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Human IgM ELISA Kit
<p>Please enquire for more information about Human IgM ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Rat C3 ELISA Kit
<p>Please enquire for more information about Rat C3 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Monkey IgM ELISA Kit
<p>The Monkey IgM ELISA kit is intended for the quantitative determination of total monkey IgM (new and old world) in biological samples.</p>Pureza:Min. 95%Purified Borrelia burgdorferi OspA Protein
<p>Borrelia burgdorferi (Lyme disease) OspA Protein is a highly purified HIS tagged recombinant protein that is derived from E.coli.</p>Pureza:Min. 95%Mouse Isotyping Kit
<p>Mouse Antibody Isotype Kit is a single-use, lateral flow-based test that in 5 minutes can identify mouse monoclonal antibody class and subclass.Reliable - Comparable results to ELISA assays.Fast - 5 minutes from start to finish.Convenient - Only requires 2 steps - dilute sample and load sample.Inexpensive - No equipment or additional reagents required.Specific - No Reactivity with Fetal Bovine Serum.</p>Pureza:Min. 95%Mouse Leptin ELISA Kit
<p>Leptin is a cell-signalling hormone vital in the regulation of appetite, food intake and body weight. Studies have shown that an absence of leptin in the body or leptin resistance can lead to uncontrolled feeding and weight gain. Because obesity is an established risk factor in various cancers and leptin plays a significant role in the physiopathology of obesity, the exploration of leptin's link to cancer risk is of considerable importance.</p>Pureza:Min. 95%PEDV Nucleocapsid Protein - Purified
<p>This Porcine epidemic diarrhea virus nucleocapsid protein is expressed in E.coli and contains a 6xHIS tag.</p>Pureza:Min. 95%Human Myeloperoxidase (MPO) ELISA Kit
<p>Please enquire for more information about Human Myeloperoxidase (MPO) ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%SDK1 antibody
<p>SDK1 antibody was raised in rabbit using the middle region of SDK1 as the immunogen</p>Pureza:Min. 95%Dog IgM ELISA Kit
<p>Please enquire for more information about Dog IgM ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Triiodothyronine ELISA Kit
<p>ELISA kit for detection of Triiodothyronine in the research laboratory</p>Pureza:Min. 95%Human Growth Hormone ELISA Kit
<p>ELISA kit for detection of Growth Hormone in the research laboratory</p>Pureza:Min. 95%Endothelin A Receptor antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Studies have shown its high frequency of human activity using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>Progesterone ELISA Kit
<p>ELISA kit for detection of Progesterone in the research laboratory</p>Pureza:Min. 95%Monkey Red Blood Cells
<p>Monkey Red Blood Cells are a valuable resource in the field of Life Sciences. These cells can be used for various applications such as studying the angiotensin-converting enzyme, neutralizing antibodies, and electrode development. Monkey Red Blood Cells are often used in research to develop monoclonal antibodies and pegylated products. They can also be used as biospecimens for the analysis of serum, plasma, and other fluids. Additionally, Monkey Red Blood Cells have been utilized in studies involving collagen, human serum, peptide agents, influenza hemagglutinin, brucella abortus, carbon quantum dots, chemokines, and growth factors. These cells offer researchers a reliable and versatile tool for their scientific investigations.</p>Pureza:Min. 95%Human GCSF ELISA kit
<p>ELISA kit for the detection of Human GCSF in the research laboratory</p>Pureza:Min. 95%Rat Ferritin ELISA Kit
<p>Please enquire for more information about Rat Ferritin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Human CD40L ELISA Kit
<p>ELISA kit for detection of CD40 in the research laboratory</p>Pureza:Min. 95%Cat IgG ELISA Kit
<p>The Cat IgG ELISA kit is intended for the quantitative determination of total cat IgG in biological samples.</p>Pureza:Min. 95%Testosterone 3 antibody
<p>Testosterone 3 antibody was raised in rabbit using testosterone-3 BSA as the immunogen.</p>SMAD6 antibody
<p>The SMAD6 antibody is a monoclonal antibody that has the ability to neutralize specific virus surface antigens. This antibody specifically targets and binds to the superoxide glucagon receptor, preventing its activation and subsequent signaling cascade. As a result, the antibody inhibits the nuclear translocation of specific antibodies involved in viral replication and immune evasion.</p>Human Lipocalin 2 ELISA kit
<p>ELISA kit for the detection of NGAL in the research laboratory</p>Pureza:Min. 95%Human Ferritin ELISA Kit
<p>Please enquire for more information about Human Ferritin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Estradiol ELISA kit
<p>ELISA kit for the detection of Estradiol in the research laboratory</p>Pureza:Min. 95%VMAT2 antibody
<p>VMAT2 antibody was raised in rabbit using a synthetic peptide from C-terminus of rat VMAT2 conjugated to BSA as the immunogen.</p>Pureza:Min. 95%Human TARC ELISA kit
<p>ELISA Kit for detection of TARC in the research laboratory</p>Pureza:Min. 95%Cip1 antibody
<p>Cip1 antibody was raised in rabbit using residues 139-164 of the p21 protein as the immunogen.</p>Pureza:Min. 95%Mac2BP ELISA kit
<p>ELISA kit for the detection of Mac2BP in the research laboratory</p>Pureza:Min. 95%Rat Laminin ELISA Kit
<p>ELISA kit for detection of Laminin in the research laboratory</p>Pureza:Min. 95%Mouse Vasopressin ELISA kit
<p>ELISA Kit for detection of Vasopressin in the research laboratory</p>Pureza:Min. 95%Human IL8 ELISA Kit
<p>ELISA kit for detection of Human IL8 in the research laboratory</p>Pureza:Min. 95%Prothrombin screen ELISA kit
<p>ELISA kit for the detection of Prothrombin screen in the research laboratory</p>Pureza:Min. 95%Mouse IGFBP1 ELISA Kit
<p>ELISA kit for detection of IGFBP1 in the research laboratory</p>Pureza:Min. 95%C1ORF131 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C1orf131 antibody, catalog no. 70R-4090</p>Pureza:Min. 95%Human Angiostatin K13 ELISA Kit
<p>ELISA Kit for detection of Angiostatin K13 in the research laboratory</p>Pureza:Min. 95%Phosphatidyl Serine IgG/IgM ELISA kit
<p>ELISA kit for the detection of Phosphatidyl Serine IgG/IgM in the research laboratory</p>Pureza:Min. 95%Testosterone ELISA Kit
<p>ELISA kit for detection of Testosterone in the research laboratory</p>Pureza:Min. 95%Tetanus toxin antibody
<p>Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.</p>Pureza:>92% By Gel Electrophoresis And Gel ScanningASCA IgA/IgG ELISA kit
<p>ELISA kit for the detection of ASCA IgA/IgG in the research laboratory</p>Pureza:Min. 95%Chicken IL17 ELISA kit
<p>ELISA Kit for detection of IL17 in the research laboratory</p>Pureza:Min. 95%LCP1 antibody
<p>LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK</p>Mouse Cystatin C ELISA Kit
<p>ELISA kit for detection of Cystatin C in the research laboratory</p>Pureza:Min. 95%Grams iodine stain
CAS:<p>Grams iodine stain is a chemical reagent that is used to detect the presence of bacteria. It can be used on both leaves and human fecal samples. The procedure involves placing a small amount of bacteria on an agar plate. The bacteria are then stained with an iodine solution, which reacts with the fatty acids in the cell walls to produce a black precipitate. This process allows for the detection of bacterial colonies by their black color. The Gram stain is named after the Danish bacteriologist Hans Christian Gram, who developed it in 1884.</p>Fórmula:I3K3Pureza:Min. 95%Peso molecular:498.01 g/molRef: 3D-MAA29868
Producto descatalogadoHuman Mullerian hormone ELISA kit
<p>ELISA Kit for detection of Mullerian hormone in the research laboratory</p>Pureza:Min. 95%Salivary Sample Collection Kit
<p>Salivary sample collection kit for the detection of free Salivary proteins and enzymes in the research laboratory</p>Pureza:Min. 95%Histamine ELISA Kit
<p>ELISA kit for detection of Histamine in the research laboratory</p>Pureza:Min. 95%Cat CRP ELISA Kit
<p>Cat CRP ELISA Kit - For the quantitative determination of c-reactive protein (CRP) in cat/feline samples.</p>Pureza:Min. 95%Mouse Free Thyroxine ELISA kit
<p>ELISA Kit for detection of Free Thyroxine in the research laboratory</p>Pureza:Min. 95%Influenza A Nucleoprotein ELISA Kit
<p>Influenza A Antigen Capture ELISA for use in the research laboratory</p>Pureza:Min. 95%Dog Thymidine Kinase (TK1) ELISA Kit
<p>Canine/Dog Thymidine Kinase (TK1) ELISA Kit</p>Pureza:Min. 95%Human PDGFAB ELISA Kit
<p>ELISA Kit for detection of PDGFAB in the research laboratory</p>Pureza:Min. 95%Rituximab Light chain (41-55)
<p>Rituximab is a chimeric monoclonal antibody used in the treatment of some cancers like CD20 non-Hodgkin's lymphoma and a few autoimmune conditions such as rheumatoid arthritis. However, antibody treatment can lead to generation of neutralising antibodies thus curtailing the efficacy of the therapy. CD 4+ T cells are critical to initiate antibody response so identification of epitopes within molecules using T cell assays can be a vital tool for understanding the immune response and thereby prevent induction of neutralising antibodies. Within rituximab, the variable region of the light chain (41-55) was found to have strong affinity for leukocytes in a specific binding assay, the epitope was also correlated to patients who developed neutralising antibodies. This T cell epitope within rituximab in further immune studies could help design or selection of antibodies without T cell epitopes present for low immunogenicity.</p>Peso molecular:1,620.8 g/molMonkey Fibrinogen ELISA Kit
<p>Fibrinogen is a glycoprotein in the blood that plays a crucial role in blood clotting and wound healing. It is produced by the liver and circulates in the blood plasma. When there is an injury that causes bleeding, fibrinogen is converted into fibrin through a series of enzymatic reactions, forming a mesh-like structure that helps to stop bleeding by forming a blood clot. This process is part of the body's natural response to injuries and is essential for maintaining hemostasis, the prevention of excessive bleeding.</p>Pureza:Min. 95%TPTE antibody
<p>TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL</p>MEF2A antibody
<p>The MEF2A antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets and inhibits the activity of MEF2A, a transcription factor involved in various cellular processes. This polyclonal antibody is highly specific and can be used for a wide range of applications in research laboratories.</p>Pureza:Min. 95%anti-TGEV Antibody
<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>Pureza:Min. 95%Mouse IgG ELISA Kit
<p>IgG is a type of antibody that plays a crucial role in the immune system. IgG antibodies are produced by plasma cells and are the most abundant type of antibody found in the bloodstream and tissues. They are involved in recognizing and neutralizing pathogens such as bacteria and viruses, as well as in activating other components of the immune system. Mouse IgG ELISA Kit accurately allows for rapid quantification of total IgG in your biological samples.</p>Pureza:Min. 95%Human Hemoglobin ELISA Kit
<p>Please enquire for more information about Human Hemoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Cat SAA ELISA Kit
<p>Cat SAA ELISA Kit - For the quantitative determination of serum amyloid A (SAA) in feline samples.</p>Pureza:Min. 95%Monkey C3 ELISA Kit
<p>Complement C3 is a protein that plays a crucial role in the immune system as part of the complement system. The complement system is a complex network of proteins that work together to enhance the immune response against pathogens such as bacteria and viruses. Complement C3 is one of the central components of this system.<br>When the complement system is activated, C3 is cleaved into two fragments: C3a and C3b. C3b plays a key role in opsonization, a process in which pathogens are marked for destruction by phagocytic cells, such as macrophages. Additionally, C3b participates in the formation of the membrane attack complex (MAC), which can directly lyse and kill certain pathogens.<br>The complement system is an essential part of the immune defense mechanism, contributing to the body's ability to recognize and eliminate foreign invaders. Dysregulation of the complement system has been associated with various autoimmune diseases and inflammatory conditions.</p>Pureza:Min. 95%Human Leptin ELISA Kit
<p>Leptin is a cell-signalling hormone vital in the regulation of appetite, food intake and body weight. Studies have shown that an absence of leptin in the body or leptin resistance can lead to uncontrolled feeding and weight gain. Because obesity is an established risk factor in various cancers and leptin plays a significant role in the physiopathology of obesity, the exploration of leptin's link to cancer risk is of considerable importance.</p>Pureza:Min. 95%Coronavirus (SARS-CoV-2) Spike S1 RBD - Purified from HEK 293
<p>Recombinant SARS-CoV-2 Spike S1 Receptor Binding Domain (RBD; GenBank QHD43416.1, a.a.318-541) with a 6xHIS tag was expressed in HEK293 cells and purified by nickel affinity chromatography. Under SDS-PAGE reducing conditions, the protein is detected at an estimated molecular weight of ~35 kDa. Optimal working dilutions should be determined experimentally by the investigator.</p>PEDV Spike Protein - Purified
<p>Purified recombinant protein from a sequence within the PEDV Spike Protein (S1) domain. Expressed and purified from CHO cells and contains a 6xHIS tag.</p>Pureza:Min. 95%CEA, CAP-1-6-D, [Asp6]-Carcinoembryonic Antigen
<p>Custom research peptide; min purity 95%.</p>Fórmula:C43H68N10O15Pureza:Min. 95%Peso molecular:965.08 g/molRef: 3D-PC16934
Producto descatalogadoHuman IL-6 ELISA Kit
<p>Interleukin 6 (IL-6) is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha.</p>Pureza:Min. 95%Hamster (CHO) GTP-binding Nuclear Protein (RAN) ELISA Kit
<p>Please enquire for more information about Hamster (CHO) GTP-binding Nuclear Protein (RAN) ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Human VDPB ELISA Kit
<p>Please enquire for more information about Human VDPB ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Human Haptoglobin ELISA Kit
<p>Please enquire for more information about Human Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Mouse IgG2A ELISA Kit
<p>Please enquire for more information about Mouse IgG2A ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Rat IgG ELISA Kit
<p>Please enquire for more information about Rat IgG ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Dog NGAL ELISA Kit
<p>A rapid immunoassay for the detection of Dog NGAL/Lipocalin-2;</p>Pureza:Min. 95%Rat IgE ELISA Kit
<p>Please enquire for more information about Rat IgE ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%TTC27 antibody
<p>TTC27 antibody was raised in rabbit using the N terminal of TTC27 as the immunogen</p>Pureza:Min. 95%Mouse IgG3 ELISA Kit
<p>Please enquire for more information about Mouse IgG3 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Mouse IgG2C ELISA Kit
<p>Inbred mouse strains such as C57BL/6, C57BL/10 and NOD with the Igh1-b allele do not have the gene for IgG2a and instead express the IgG2c isotype.</p>Pureza:Min. 95%FSH antibody
<p>The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.</p>Pureza:Min. 95%Sheep IgG ELISA Kit
<p>The Sheep IgG ELISA kit is intended for the quantitative determination of total sheep IgG in biological samples.</p>Pureza:Min. 95%β-Sinensal
CAS:<p>β-Sinensal is an analog of astaxanthin that has shown potent inhibitory activity against human kinases. This compound has been shown to induce apoptosis in cancer cells and inhibit tumor growth in Chinese hamsters. β-Sinensal has also been found in human urine, suggesting that it may have a role in regulating cellular replication. In addition, this compound has demonstrated synergistic effects with methotrexate, a commonly used cancer drug. β-Sinensal is a promising inhibitor of kinases and may have potential as a therapeutic agent for the treatment of cancer.</p>Fórmula:C15H22OPureza:Min. 95%Peso molecular:218.33 g/molRef: 3D-KCA06688
Producto descatalogadoMouse IgG1 ELISA Kit
<p>Please enquire for more information about Mouse IgG1 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Chicken Ovotransferrin (Conalbumin) ELISA Kit
<p>Ovotransferrin is an acute-phase protein with iron-binding and immunomodulatory functions.</p>Pureza:Min. 95%Human IgG ELISA Kit
<p>IgG is a type of antibody that plays a crucial role in the immune system. IgG antibodies are produced by plasma cells and are the most abundant type of antibody found in the bloodstream and tissues. They are involved in recognizing and neutralizing pathogens such as bacteria and viruses, as well as in activating other components of the immune system. IgG antibodies also play a role in immune responses to vaccines and in providing passive immunity, such as through maternal antibodies transferred to infants during breastfeeding. Human IgG ELISA Kit accurately allows for rapid quantification of total IgG in your biological samples.</p>Pureza:Min. 95%Bovine IgG ELISA Kit
<p>This Bovine IgG ELISA kit is intended for the quantitative determination of total bovine IgG. There is no reactivity to human, mouse, rabbit and rat immunoglobulins.</p>Pureza:Min. 95%Mouse Hemoglobin ELISA Kit
<p>Please enquire for more information about Mouse Hemoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Canine Prostaglandin E2 ELISA kit
<p>ELISA Kit for detection of Prostaglandin E2 in the research laboratory</p>Pureza:Min. 95%Human Plasminogen ELISA Kit
<p>Please enquire for more information about Human Plasminogen ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Hamster CHO Matrix metalloproteinase-19 (MMP-19) ELISA Kit
<p>Hamster (CHO) Matrix metalloproteinase-19 (MMP-19) ELISA Kit</p>Pureza:Min. 95%Mouse Prealbumin ELISA Kit
<p>Please enquire for more information about Mouse Prealbumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%IgG1 κ Isotype Control Fc fusion protein (PE)
<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein (PE)</p>Pureza:Min. 95%Mouse VEGF ELISA kit
<p>ELISA kit for the detection of Human VEGF in the research laboratory</p>Pureza:Min. 95%Rat Free Thyroxine ELISA kit
<p>ELISA Kit for detection of Free Thyroxine in the research laboratory</p>Pureza:Min. 95%Human IL25 ELISA kit
<p>ELISA Kit for detection of IL25 in the research laboratory</p>Pureza:Min. 95%Rat/Mouse Corticosterone ELISA kit
<p>ELISA kit for the detection of Rat/Mouse Corticosterone in the research laboratory</p>Pureza:Min. 95%Human CRP ELISA Kit
<p>C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.<br>High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.<br>;</p>Pureza:Min. 95%TSH antibody
<p>TSH antibody was raised in rabbit using human TSH as the immunogen.</p>Pureza:Min. 95%Human P-Selectin ELISA Kit
<p>ELISA kit for detection of P-Selectin in the research laboratory</p>Pureza:Min. 95%Nucleosome ELISA kit
<p>ELISA kit for the detection of Nucleosome in the research laboratory</p>Pureza:Min. 95%Rabbit MMP1 ELISA kit
<p>ELISA Kit for detection of MMP1 in the research laboratory</p>Pureza:Min. 95%Rat Leptin ELISA kit
<p>ELISA Kit for detection of Leptin in the research laboratory</p>Pureza:Min. 95%Rheumatoid Factor IgM ELISA kit
<p>ELISA kit for the detection of Rheumatoid Factor IgM in the research laboratory</p>Pureza:Min. 95%Thymus peptide C
CAS:<p>Thymus peptide C is a peptide that is an inhibitor of Protein interactions. It binds to the receptor and activates the Ligand, which then inhibits ion channels. Thymus peptide C has been used as a research tool to study the inhibition of ion channels in cells. This peptide has also been used as an antibody for the detection of antigens that are associated with cell proliferation.</p>Pureza:Min. 95%Peso molecular:1,000 g/molRef: 3D-RMA79123
Producto descatalogadoHuman IL12 ELISA Kit (p70)
<p>ELISA Kit for detection of IL12 (p70) in the research laboratory</p>Pureza:Min. 95%Coagulation Factor III ELISA kit
<p>ELISA Kit for detection of Mouse Coagulation Factor III in the research laboratory</p>Pureza:Min. 95%Sodium pyrophosphate decahydrate
CAS:<p>Sodium pyrophosphate decanhydrate is a methyltransferase inhibitor that blocks the enzyme form of the DNA methyltransferase, which is responsible for maintaining DNA methylation patterns. It has been shown to inhibit the enzymatic activity of this enzyme in a model system. Sodium pyrophosphate decanhydrate inhibits the growth of bacteria by binding to water molecules and preventing them from binding to other molecules, causing dehydration. This drug also has potential as a natriuretic peptide levels inhibitor, with electrochemical impedance spectroscopy studies showing that it may have a high affinity for sodium ions. Studies have also shown that sodium pyrophosphate decanhydrate has no toxicity in mice.</p>Fórmula:H4O7P2•Na4•(H2O)10Pureza:Min. 95%Forma y color:PowderPeso molecular:450.09 g/molRef: 3D-FS64805
Producto descatalogadoHuman Cystatin C ELISA kit
<p>ELISA kit for the detection of Cystatin C in the research laboratory</p>Pureza:Min. 95%Human VCAM1 ELISA Kit
<p>ELISA kit for detection of VCAM1 in the research laboratory</p>Pureza:Min. 95%Rabbit MMP2 ELISA kit
<p>ELISA Kit for detection of MMP2 in the research laboratory</p>Pureza:Min. 95%Horse IgG ELISA Kit
<p>Horse IgG ELISA kit is intended for the quantitative determination of total horse IgG in biological samples.</p>Pureza:Min. 95%Pig IgG ELISA Kit
<p>The Pig IgG ELISA kit is intended for the quantitative determination of total pig IgG in biological samples.</p>Pureza:Min. 95%Head activator
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C54H84N12O14Peso molecular:1,125.36 g/molAmyloid beta-Protein (36-38)
CAS:<p>Amyloid beta-Protein (36-38) is a peptide that has molecular weight of 4.3 kDa. It is a fragment of amyloid precursor protein, which is cleaved by enzymes in the brain to create the peptide. Amyloid beta-Protein (36-38) has been found to be involved in Alzheimer's disease as it aggregates into β-sheet bundles and forms amyloid plaques in the brain. This protein can be detected using vibrational spectroscopy and has been observed to have a strain that changes depending on pH. This molecule also undergoes proteolysis by peptidases, which break down proteins into amino acids for analysis with an amino acid analyzer. The solute can be analyzed with an acid analysis or spectrometer, which are used to determine functional groups such as carboxylic acids, hydroxyls, or amides. Amyloid beta-Protein (36-38)</p>Fórmula:C9H17N3O4Pureza:Min. 95%Peso molecular:231.25 g/molRef: 3D-FA109475
Producto descatalogadoH-His-Arg-OH
CAS:<p>H-His-Arg-OH is a synthetic peptide that has been shown to have cytotoxic effects on mammalian cells. The H-His-Arg-OH peptide can be used for the treatment of heart disease and autoimmune diseases, such as rheumatoid arthritis. This peptide has been found to be resistant to congestive heart failure, which is caused by a number of factors, including hypertension and valvular stenosis. It has also been shown to have an immunoglobulin G1 (IgG1) genotype.</p>Fórmula:C12H21N7O3Pureza:Min. 95%Peso molecular:311.34 g/molRef: 3D-FH108062
Producto descatalogadoMyelin Oligodendrocyte Glycoprotein (35-55) (mouse, rat) trifluoroacetate
CAS:<p>Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.</p>Fórmula:C118H177N35O29S•C2HO2F3Pureza:Min. 95%Forma y color:PowderPeso molecular:2,695.98 g/molRef: 3D-FM109206
Producto descatalogadoCJC-1295
CAS:<p>CJC-1295 is a synthetic peptide, which is an analogue of growth hormone-releasing hormone (GHRH). It is synthesized through recombinant DNA technology, which allows for precise control over its sequence and length. This particular peptide is designed to bind to GHRH receptors in the pituitary gland. By activating these receptors, CJC-1295 stimulates the release of growth hormone (GH) into the bloodstream.The primary function of CJC-1295 is to influence the endocrine system, particularly enhancing the release of endogenous growth hormone. It achieves this by increasing the amplitude and frequency of GH pulses without affecting the natural negative feedback mechanisms that regulate GH production. This mode of action distinguishes CJC-1295 from other growth hormone therapies, as it promotes a more physiological pattern of hormone secretion.CJC-1295 is used in various scientific contexts, primarily in research focusing on growth hormone deficiencies, muscle wasting conditions, and certain metabolic disorders. Its ability to increase GH release also makes it a subject of interest in studies related to aging, tissue repair, and regeneration. The longer half-life of CJC-1295 compared to natural GHRH peptides further enhances its applications in research, allowing for more sustained and controlled experimentation.</p>Pureza:Min. 95%Ref: 3D-FC138107
Producto descatalogadoProlactin Releasing Peptide (1-31), bovine
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C157H244N54O41SPeso molecular:3,576.01 g/molMesotocin trifluroacetate
CAS:<p>Mesotocin is a peptide hormone that has a role in the regulation of water permeability and estradiol benzoate. It also regulates the physiological functions of the brain and has been shown to be involved in congestive heart failure, as it causes an increase in blood pressure. Mesotocin is found at high levels in human serum, but its activity is dependent on the presence of other hormones such as estradiol benzoate. The biological properties of mesotocin are largely unknown, although it is known to have receptor activity. The effects of this hormone on the kidney have been studied using mesotocin trifluroacetate (MTFA) and monoclonal antibody (mAb). MTFA causes an increase in glomerular filtration rate (GFR), which may be due to its ability to inhibit angiotensin II-induced vasoconstriction and decrease vascular resistance.</p>Fórmula:C43H66N12O12S2Pureza:Min. 95%Peso molecular:1,007.19 g/molRef: 3D-FI108690
Producto descatalogado05:0 PC
CAS:<p>05:0 PC is a peptide binding sequence that has been shown to inhibit the replication of viral sequences. 05:0 PC binds to the amino acid sequence in protein, which is a model system for peptide binding. The endoplasmic reticulum, or ER, is the site of synthesis for proteins and its low efficiency may be due to the spontaneous nature of the protein synthesis process. The ER can also be seen as an inhibitor molecule that prevents the virus from replicating. 05:0 PC has been shown to inhibit papillomavirus and HIV-1 replication in vitro. This peptide has also been shown to block interactions between viruses and cells that allow viral replication.</p>Fórmula:C18H36NO8PPureza:Min. 95%Peso molecular:425.45 g/molRef: 3D-RCA41434
Producto descatalogado[Ala81]-MBP (74-85)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C55H94N20O21Peso molecular:1,371.48 g/mol
