Compuestos y reactivos bioquímicos
Los bioquímicos y reactivos son sustancias fundamentales para la investigación y el desarrollo en campos como la biotecnología, la biología molecular, la farmacología y la medicina. Estos productos son esenciales para una variedad de aplicaciones, incluyendo la síntesis de compuestos, el análisis de muestras biológicas, la investigación de procesos metabólicos y la producción de medicamentos. En CymitQuimica, ofrecemos una amplia selección de bioquímicos y reactivos de alta calidad y pureza, adecuados para diversas necesidades científicas e industriales. Nuestro catálogo incluye enzimas, anticuerpos, ácidos nucleicos, aminoácidos, y muchos otros productos, todos diseñados para apoyar a los investigadores y profesionales en sus proyectos de investigación y desarrollo, asegurando resultados confiables y reproducibles.
Subcategorías de "Compuestos y reactivos bioquímicos"
- Biomoléculas(99.129 productos)
- Por objetivo biológico(99.160 productos)
- Según efectos farmacológicos(6.787 productos)
- Crioconservantes(21 productos)
- Desinfectantes y compuestos relacionados(28 productos)
- Hormonas(346 productos)
- Biología Vegetal(6.742 productos)
- Metabolitos secundarios(14.222 productos)
Se han encontrado 130579 productos de "Compuestos y reactivos bioquímicos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Human Calcitonin ELISA kit
<p>ELISA Kit for detection of Calcitonin in the research laboratory</p>Pureza:Min. 95%Rat Clusterin ELISA Kit
<p>Rat Clusterin ELISA Kit<br>Clusterin plays key roles in protein homeostasis/proteostasis, and the modulation of pro-survival signaling networks.</p>Pureza:Min. 95%Amelubant
CAS:<p>Amelubant is a synthetic compound designed for use in detailed biochemical research and therapeutic investigations. As a product derived from innovative chemical synthesis techniques, Amelubant is engineered to interact with particular biological pathways, predominantly in the field of inflammatory response modulation. Its mode of action involves specific binding to target receptors, influencing downstream signaling cascades.</p>Fórmula:C33H34N2O5Pureza:Min. 95%Peso molecular:538.6 g/molRef: 3D-WNA73524
Producto descatalogadoDog IgE ELISA Kit
<p>Please enquire for more information about Dog IgE ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Mouse BAFF ELISA Kit
<p>ELISA kit for detection of BAFF in the research laboratory</p>Pureza:Min. 95%Toxoplasma gondii IgG ELISA kit
<p>ELISA kit for the detection of Toxoplasma gondii IgG in the research laboratory</p>Pureza:Min. 95%P2RX2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of P2RX2 antibody, catalog no. 70R-5171</p>Pureza:Min. 95%Human IgA ELISA Kit
<p>Please enquire for more information about Human IgA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Human Hemopexin ELISA Kit
<p>Please enquire for more information about Human Hemopexin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%HPV18 antibody
<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>SYT11 antibody
<p>SYT11 antibody was raised in rabbit using the N terminal of SYT11 as the immunogen</p>Pureza:Min. 95%CHO CTSA ELISA Kit
<p>Please enquire for more information about CHO CTSA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%PDE3B antibody
<p>The PDE3B antibody is a protein-based product that belongs to the category of antibodies. It is specifically designed to target and bind to the PDE3B enzyme, which plays a crucial role in various cellular processes. This monoclonal antibody has been extensively tested and validated for its specificity and efficacy.</p>Endothelin A Receptor antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Studies have shown its high frequency of human activity using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>MicroAlbumin ELISA kit
<p>ELISA kit for the detection of MicroAlbumin in the research laboratory</p>Pureza:Min. 95%Human Laminin ELISA Kit
<p>ELISA kit for detection of Laminin in the research laboratory</p>Pureza:Min. 95%SDK1 antibody
<p>SDK1 antibody was raised in rabbit using the middle region of SDK1 as the immunogen</p>Pureza:Min. 95%MYBPH antibody
<p>MYBPH antibody was raised using the N terminal of MYBPH corresponding to a region with amino acids LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP</p>Pureza:Min. 95%Dysprosium(III) bromide
CAS:<p>Dysprosium(III) bromide is an ionic compound that is an essential component of many high-temperature superconductors. This compound has a stoichiometric ratio of 1:1, which means that the number of dysprosium atoms in the formula is equal to the number of bromide ions. The experimental transport properties for this compound have been determined using a series of experiments. Transport activity coefficients and transition temperatures were calculated using quadratic equations. The solubility data for Dysprosium(III) bromide has been determined at several temperatures, as well as its eutectic point and melting point constants.</p>Fórmula:Br3DyPureza:Min. 95%Peso molecular:402.21 g/molRef: 3D-FD171801
Producto descatalogadoCanine MMP1 ELISA kit
<p>ELISA Kit for detection of MMP1 in the research laboratory</p>Pureza:Min. 95%Rat B2M ELISA Kit
<p>Rat Beta 2-Microglobulin ELISA Kit<br>Beta 2-Microglobulin is a component of the major histocompatibility complex involving the presentation of peptide antigens to the immune system.</p>Pureza:Min. 95%AMC
CAS:<p>AMC is a peptide that acts as an activator of the nicotinic acetylcholine receptor. AMC is a high-purity, ion channel ligand with a CAS No. 26093-31-2. It is used in life science research to study cell biology and pharmacology. AMC has been shown to be an inhibitor of the enzyme acetylcholinesterase (AChE) in rat brain slices and it has been reported that it can inhibit the proliferation of human leukemia cells.END></p>Fórmula:C10H9NO2Pureza:Min. 95%Peso molecular:175.18 g/molDog Albumin ELISA Kit
<p>For the quantitative determination of canine/dog albumin in biological samples.</p>Pureza:Min. 95%Human Plasminogen ELISA Kit
<p>Please enquire for more information about Human Plasminogen ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%5HIAA ELISA Kit
<p>5HIAA ELISA Kit for the quantitative determination of 5HIAA in urine</p>Pureza:Min. 95%Dog IgM ELISA Kit
<p>Please enquire for more information about Dog IgM ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Human IgG ELISA Kit
<p>IgG is a type of antibody that plays a crucial role in the immune system. IgG antibodies are produced by plasma cells and are the most abundant type of antibody found in the bloodstream and tissues. They are involved in recognizing and neutralizing pathogens such as bacteria and viruses, as well as in activating other components of the immune system. IgG antibodies also play a role in immune responses to vaccines and in providing passive immunity, such as through maternal antibodies transferred to infants during breastfeeding. Human IgG ELISA Kit accurately allows for rapid quantification of total IgG in your biological samples.</p>Pureza:Min. 95%Coronavirus (SARS-CoV-2) Nucleoprotein - Purified
<p>Recombinant SARS-CoV-2 Nucleocapsid Protein (GenBank# QHD43423.2, a.a.1-419) with a 6xHIS tag was expressed in E. coli and purified by nickel affinity chromatography.</p>Pureza:Min. 95%Human TGFB1 ELISA Kit
<p>ELISA Kit for detection of TGFB1 in the research laboratory</p>Pureza:Min. 95%Hamster CHO Annexin A5 ELISA Kit
<p>Hamster (CHO) Annexin A5 ELISA Kit<br>Â <br>Annexin A5 is a host cell protein (HCP) generated by CHO cells during production of biotherapeutics. This process-related impurity accumulates in the extracellular space as it is released from dead CHO cells and secreted from viable cells during cell culture. Annexin A5 is highly immunogenic and may cause dangerous adverse reactions if present in a therapeutic drug formulation.</p>Pureza:Min. 95%Human IL18 ELISA Kit
<p>ELISA kit for detection of IL18 in the research laboratory</p>Pureza:Min. 95%Rat IgA ELISA Kit
<p>Please enquire for more information about Rat IgA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%GRK5 antibody
<p>GRK5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Pureza:Min. 95%Mouse IgG2B ELISA Kit
<p>Please enquire for more information about Mouse IgG2B ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Goat IgG ELISA Kit
<p>The Goat IgG ELISA kit is intended for the quantitative determination of total goat IgG in biological samples. This product will not react with sheep IgG or Bovine IgG.</p>Pureza:Min. 95%Mouse IgG1 ELISA Kit
<p>Please enquire for more information about Mouse IgG1 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Human α 1-Microglobulin ELISA Kit
<p>Please enquire for more information about Human Alpha 1-Microglobulin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Phospholipid Screen IgG/IgM ELISA kit
<p>ELISA kit for the detection of Phospholipid Screen IgG/IgM in the research laboratory</p>Pureza:Min. 95%Mouse IgA ELISA Kit
<p>Please enquire for more information about Mouse IgA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Rat IgE ELISA Kit
<p>Please enquire for more information about Rat IgE ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Bovine Serum Albumin
CAS:<p>Bovine Serum Albumin (BSA) is a protein that is used in the pharmaceutical industry as a research tool and an immunological reagent. BSA can be used to bind, stabilize, and prevent denaturation of other proteins in the laboratory. It has been shown to inhibit ion channels and ligand-gated ion channels, which are important for membrane potentials. BSA is also an activator of receptor tyrosine kinases, which are involved in cell signaling pathways.</p>Pureza:Min. 95%Rubella ELISA Kit
<p>ELISA kit for detection of Rubella in the research laboratory</p>Pureza:Min. 95%Mouse Ferritin ELISA Kit
<p>Please enquire for more information about Mouse Ferritin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%PEDV Nucleocapsid Protein - Purified
<p>This Porcine epidemic diarrhea virus nucleocapsid protein is expressed in E.coli and contains a 6xHIS tag.</p>Pureza:Min. 95%Influenza A Calibration Kit
<p>Influenza A Calibration Kit for the production of Influenza A Nucleoprotein calibration curve</p>Pureza:Min. 95%Donkey anti Chicken IgY (H + L) (HRP)
<p>Donkey anti-chicken IgY (H + L) (HRP) was raised in donkey using chicken IgG (H & L) as the immunogen.</p>Human AGP ELISA Kit
<p>Human Alpha 1-Acid Glycoprotein (AGP/Orosomucoid) ELISA Kit</p>Pureza:Min. 95%Azido-dPEG®3-Amine
CAS:<p>Azido-dPEG®3-Amine is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®3-Amine is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Pureza:Min. 95%Peso molecular:218.25 g/molThyroglobulin ELISA kit
<p>ELISA kit for the detection of Thyroglobulin in the research laboratory</p>Pureza:Min. 95%Thyroxine ELISA Kit
<p>ELISA kit for detection of Thyroxine in the research laboratory</p>Pureza:Min. 95%Human IL25 ELISA kit
<p>ELISA Kit for detection of IL25 in the research laboratory</p>Pureza:Min. 95%Serotonin ELISA Kit
<p>ELISA kit for detection of Serotonin in the research laboratory</p>Pureza:Min. 95%Rheumatoid Factor IgA ELISA kit
<p>ELISA kit for the detection of Rheumatoid Factor IgA in the research laboratory</p>Pureza:Min. 95%Bestatin-amido-Me
CAS:<p>Bestatin-amido-Me is a high purity, water soluble, and stable small molecule that can be used as a pharmacological research tool. It has been shown to inhibit protein interactions with receptors in the human body. Bestatin-amido-Me is also an inhibitor of ion channels and ligands for antibodies. This substance has been shown to inhibit receptor activation by peptides or other ligands at concentrations of 1mM or less. The chemical name for this substance is bestatin amide methylamide hydrochloride and its CAS number is 339186-54-8.</p>Fórmula:C17H27N3O3Pureza:Min. 95%Peso molecular:321.4 g/molRef: 3D-PNA18654
Producto descatalogadoSperm Antibodies ELISA kit
<p>ELISA kit for the detection of Sperm Antibodies in the research laboratory</p>Pureza:Min. 95%Mouse Prolactin ELISA kit
<p>ELISA Kit for detection of Prolactin in the research laboratory</p>Pureza:Min. 95%Affinity Purified anti-Human Ferritin Antibody
<p>Affinity Purified Rabbit anti-Human Ferritin Antibody</p>Pureza:Min. 95%Rat MIP3 α ELISA Kit
<p>ELISA Kit for detection of MIP3 alpha in the research laboratory</p>Pureza:Min. 95%Human Perforin 1 ELISA kit
<p>ELISA Kit for detection of Perforin 1 in the research laboratory</p>Pureza:Min. 95%Rat PPARa ELISA kit
<p>ELISA Kit for detection of PPARa in the research laboratory</p>Pureza:Min. 95%Porcine Leptin ELISA kit
<p>ELISA Kit for detection of Leptin in the research laboratory</p>Pureza:Min. 95%ILK-IN-2
CAS:<p>ILK-IN-2 is a molecule that inhibits autophagy in leukemia cells. It has been shown to be effective in inhibiting the growth of meningioma and lymphocytic leukemia cells. ILK-IN-2 has also shown inhibitory properties against chronic lymphocytic leukemia and primary cells, which may be due to its ability to induce apoptosis by activating proapoptotic molecules such as Bax, Bak, and caspase-3. In addition, ILK-IN-2 has demonstrated anti-inflammatory properties that may lead to its use in autoimmune diseases.</p>Fórmula:C30H30F3N5OPureza:Min. 95%Peso molecular:533.59 g/molRef: 3D-IDC14624
Producto descatalogadoDecorsin
<p>Decorsin is a research tool that is an activator and ligand for the human receptor. It binds to the receptor by altering its conformation, which leads to cell signaling. Decorsin has been shown to inhibit ion channels, such as potassium channels, and may also function as a receptor antagonist. Decorsin is a high-purity protein with a purity of > 95%. This protein is used in cell biology, pharmacology, and life science research. It can be used as an inhibitor of peptides in the field of protein interactions.</p>Fórmula:C179H271N55O62S6Pureza:Min. 95%Peso molecular:4,377.8 g/molβ-Sinensal
CAS:<p>β-Sinensal is an analog of astaxanthin that has shown potent inhibitory activity against human kinases. This compound has been shown to induce apoptosis in cancer cells and inhibit tumor growth in Chinese hamsters. β-Sinensal has also been found in human urine, suggesting that it may have a role in regulating cellular replication. In addition, this compound has demonstrated synergistic effects with methotrexate, a commonly used cancer drug. β-Sinensal is a promising inhibitor of kinases and may have potential as a therapeutic agent for the treatment of cancer.</p>Fórmula:C15H22OPureza:Min. 95%Peso molecular:218.33 g/molRef: 3D-KCA06688
Producto descatalogadoAcetic acid-13C2, d3
CAS:Producto controlado<p>Please enquire for more information about Acetic acid-13C2, d3 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C2H4O2Pureza:Min. 95%Ref: 3D-HEA74570
Producto descatalogadoCysteine
<p>Cysteine peptide (Ac RFAAKAA COOH) is used in combination with Lysinepeptide (Ac RFAACAA COOH) in the Direct Peptide Reactivity Assay (DPRA) test.<br>Direct Peptide Reactivity Assay is used in cosmetic applications for the characterization of the skin sensitizing potential of a substance, framed by OECD Guideline no 442.<br>The molecular initiating event (MIE) in skin sensitization is a binding between epidermal proteins and the sensitizing chemical substance. MIE is part of the adverse outcome pathway (AOP) of skin sensitization.<br>It is thanks to the properties of Lysine peptide and Cysteine peptide that the chemical binding will be able to take place, so these synthetic heptapeptides will mimic the reaction of a skin exposed to a substance.<br>Binding between nucleophilic proteins and electrophile substance will be measured by High Performance Liquid Chromatography (HPLC). Therefore, the decrease in Lysine peptide and Cysteine peptide levels will be a sign of sensitizing event. Depending on the rate of depletion, the sensitizing character of a molecule will be determined (see table at the bottom of the page).<br>In chemico DPRA test also has wider applications such as hazard classification in cosmetics, but also for pharmaceuticals and biocides. It is a good alternative to animal experimentation.</p>Fórmula:C32H50O9N10S1Peso molecular:750.87 g/molHuman Mullerian hormone ELISA kit
<p>ELISA Kit for detection of Mullerian hormone in the research laboratory</p>Pureza:Min. 95%3,7,11,15,19,23,27,31,35-nonamethyl-2E,6E,10E,34-hexatriacontatetraene-1,15,19,23,27,31-hexol
CAS:<p>Please enquire for more information about 3,7,11,15,19,23,27,31,35-nonamethyl-2E,6E,10E,34-hexatriacontatetraene-1,15,19,23,27,31-hexol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C45H84O6Pureza:Min. 95%Peso molecular:721.1 g/molRef: 3D-DIA06135
Producto descatalogadoHuman Ferritin ELISA Kit
<p>Please enquire for more information about Human Ferritin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Monkey Fibrinogen ELISA Kit
<p>Fibrinogen is a glycoprotein in the blood that plays a crucial role in blood clotting and wound healing. It is produced by the liver and circulates in the blood plasma. When there is an injury that causes bleeding, fibrinogen is converted into fibrin through a series of enzymatic reactions, forming a mesh-like structure that helps to stop bleeding by forming a blood clot. This process is part of the body's natural response to injuries and is essential for maintaining hemostasis, the prevention of excessive bleeding.</p>Pureza:Min. 95%Human VEGF ELISA kit
<p>ELISA Kit for detection of VEGF in the research laboratory</p>Pureza:Min. 95%CA 19-9 ELISA kit
<p>ELISA kit for the detection of CA 199 in the research laboratory</p>Pureza:Min. 95%Rat Albumin ELISA Kit
<p>Please enquire for more information about Rat Albumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Pig Haptoglobin ELISA Kit
<p>Please enquire for more information about Pig Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Rat Hemoglobin ELISA Kit
<p>Please enquire for more information about Rat Hemoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Mouse IgG ELISA Kit
<p>IgG is a type of antibody that plays a crucial role in the immune system. IgG antibodies are produced by plasma cells and are the most abundant type of antibody found in the bloodstream and tissues. They are involved in recognizing and neutralizing pathogens such as bacteria and viruses, as well as in activating other components of the immune system. Mouse IgG ELISA Kit accurately allows for rapid quantification of total IgG in your biological samples.</p>Pureza:Min. 95%anti-TGEV Antibody
<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>Pureza:Min. 95%Human Osteopontin ELISA Kit
<p>Human Osteopontin ELISA is intended for the quantitative determination of human osteopontin in biological samples.</p>Pureza:Min. 95%Chicken Ovotransferrin (Conalbumin) ELISA Kit
<p>Ovotransferrin is an acute-phase protein with iron-binding and immunomodulatory functions.</p>Pureza:Min. 95%Mouse IgE ELISA Kit
<p>Please enquire for more information about Mouse IgE ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%α Fodrin ELISA kit
<p>ELISA kit for the detection of Alpha Fodrin in the research laboratory</p>Pureza:Min. 95%ssDNA ELISA kit
<p>ELISA kit for the detection of ssDNA in the research laboratory</p>Pureza:Min. 95%Bovine IgG ELISA Kit
<p>This Bovine IgG ELISA kit is intended for the quantitative determination of total bovine IgG. There is no reactivity to human, mouse, rabbit and rat immunoglobulins.</p>Pureza:Min. 95%Human Prolactin ELISA kit
<p>ELISA Kit for detection of Prolactin in the research laboratory</p>Pureza:Min. 95%Mouse Hemoglobin ELISA Kit
<p>Please enquire for more information about Mouse Hemoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Hamster CHO Legumain ELISA Kit
<p>Hamster (CHO) Legumain ELISA Kit<br>Â <br>Legumain is a host cell protein (HCP) generated by CHO cells during production of biotherapeutics. This process-related impurity accumulates in the extracellular space as it is released from dead CHO cells and secreted from viable cells during cell culture. Legumain, a lysosomal protease, cleaves the asparaginyl and aspartyl bonds of therapeutic monoclonal antibodies, thus compromising their integrity, stability, and efficacy.</p>Pureza:Min. 95%CHO LPLA2 ELISA Kit
<p>Please enquire for more information about CHO LPLA2 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%TAPI-2
CAS:<p>TAPI-2 is an inhibitor of ADAM-17 (also called TACE) and matrix metalloproteinases (MMPs). It acts as a broad-spectrum inhibitor of these enzymes. TAPI-2 prevents the shedding of tumor necrosis factor-alpha (TNF-α) from cell membranes and can sensitize cancer stem cells to the effects of chemotherapy such as 5-fluorouracil (5-FU) in vitro. It also blocks the phorbol ester-induced shedding of other cell surface proteins like TGF-α and β-amyloid precursor protein.</p>Fórmula:C19H37N5O5Pureza:Min. 95%Peso molecular:415.53 g/molRef: 3D-MHA03431
Producto descatalogadoHuman IL4 ELISA Kit
<p>ELISA kit for detection of Human IL4 in the research laboratory</p>Pureza:Min. 95%Hamster CHO Matrix metalloproteinase-19 (MMP-19) ELISA Kit
<p>Hamster (CHO) Matrix metalloproteinase-19 (MMP-19) ELISA Kit</p>Pureza:Min. 95%Mouse Prealbumin ELISA Kit
<p>Please enquire for more information about Mouse Prealbumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Human CRP ELISA Kit
<p>C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.<br>High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.<br>;</p>Pureza:Min. 95%Horse IgG ELISA Kit
<p>Horse IgG ELISA kit is intended for the quantitative determination of total horse IgG in biological samples.</p>Pureza:Min. 95%Rat Ferritin ELISA Kit
<p>Please enquire for more information about Rat Ferritin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Cat IgG ELISA Kit
<p>The Cat IgG ELISA kit is intended for the quantitative determination of total cat IgG in biological samples.</p>Pureza:Min. 95%Cat CRP ELISA Kit
<p>Cat CRP ELISA Kit - For the quantitative determination of c-reactive protein (CRP) in cat/feline samples.</p>Pureza:Min. 95%Dog Thymidine Kinase (TK1) ELISA Kit
<p>Canine/Dog Thymidine Kinase (TK1) ELISA Kit</p>Pureza:Min. 95%Lactoferrin ELISA kit
<p>ELISA kit for the detection of Lactoferrin in the research laboratory</p>Pureza:Min. 95%Mouse IL16 ELISA kit
<p>ELISA Kit for detection of IL16 in the research laboratory</p>Pureza:Min. 95%PDGFB antibody
<p>PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD</p>Pureza:Min. 95%Cathepsin G ELISA kit
<p>ELISA kit for the detection of Cathepsin G in the research laboratory</p>Pureza:Min. 95%Rat Triiodothyronine ELISA kit
<p>ELISA Kit for detection of Triiodothyronine in the research laboratory</p>Pureza:Min. 95%IgG1 κ Isotype Control Fc fusion protein (PE)
<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein (PE)</p>Pureza:Min. 95%Human Bax ELISA kit
<p>ELISA kit for the detection of Human Bax in the research laboratory</p>Pureza:Min. 95%Human IL6 ELISA Kit
<p>ELISA kit for detection of Human IL6 in the research laboratory</p>Pureza:Min. 95%Cardiolipin screen IgG/IgM/IgA1 ELISA kit
<p>ELISA kit for the detection of Cardiolipin screen IgG/IgM/IgA1 in the research laboratory</p>Pureza:Min. 95%Rat Estradiol ELISA kit
<p>ELISA Kit for detection of Estradiol in the research laboratory</p>Pureza:Min. 95%Chlamydia pneumoniae IgG ELISA kit
<p>ELISA kit for the detection of Chlamydia pneumoniae IgG in the research laboratory</p>Pureza:Min. 95%Mouse Laminin ELISA Kit
<p>ELISA kit for detection of Laminin in the research laboratory</p>Pureza:Min. 95%Rat PDGFAB ELISA Kit
<p>ELISA Kit for detection of PDGFAB in the research laboratory</p>Pureza:Min. 95%Human MMP3 ELISA Kit
<p>ELISA Kit for detection of MMP3 in the research laboratory</p>Pureza:Min. 95%IgG1 κ Isotype Control Fc fusion protein (FITC)
<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein (FITC)</p>Pureza:Min. 95%Mouse MMP2 ELISA kit
<p>ELISA Kit for detection of MMP2 in the research laboratory</p>Pureza:Min. 95%Human P-Selectin ELISA Kit
<p>ELISA kit for detection of P-Selectin in the research laboratory</p>Pureza:Min. 95%Human ICAM1 ELISA kit
<p>ELISA Kit for detection of ICAM1 in the research laboratory</p>Pureza:Min. 95%Coronavirus (SARS-CoV-2) Spike S1 RBD - Purified from HEK 293
<p>Recombinant SARS-CoV-2 Spike S1 Receptor Binding Domain (RBD; GenBank QHD43416.1, a.a.318-541) with a 6xHIS tag was expressed in HEK293 cells and purified by nickel affinity chromatography. Under SDS-PAGE reducing conditions, the protein is detected at an estimated molecular weight of ~35 kDa. Optimal working dilutions should be determined experimentally by the investigator.</p>Rat Free Thyroxine ELISA kit
<p>ELISA Kit for detection of Free Thyroxine in the research laboratory</p>Pureza:Min. 95%Annexin V ELISA kit
<p>ELISA kit for the detection of Annexin V in the research laboratory</p>Pureza:Min. 95%Human Complement C3a des Arg ELISA kit
<p>ELISA kit for the detection of Human Complement C3a des Arg in the research laboratory</p>Pureza:Min. 95%Thyroid peroxidase ELISA kit
<p>ELISA kit for the detection of Thyroid peroxidase in the research laboratory</p>Pureza:Min. 95%Hamster (CHO) Glutathione S-Transferase P - ELISA Kit
<p>Hamster (CHO) Glutathione S Transferase Pi (GSTp) ELISA Kit<br>Glutathione S-transferase Pi (GSTp) is a metabolic enzyme that facilitates metabolite detoxification and antioxidation. GSTp reduces efficacy of chemotherapy drugs and inhibits tumor-cell apoptosis.</p>Pureza:Min. 95%dsDNA IgM ELISA kit
<p>ELISA kit for the detection of dsDNA IgM in the research laboratory</p>Pureza:Min. 95%Human IL-6 ELISA Kit
<p>Interleukin 6 (IL-6) is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha.</p>Pureza:Min. 95%von Willebrand Factor ELISA Kit
<p>ELISA Kit for detection of von Willebrand Factor in the research laboratory</p>Pureza:Min. 95%SMAD6 antibody
<p>The SMAD6 antibody is a monoclonal antibody that has the ability to neutralize specific virus surface antigens. This antibody specifically targets and binds to the superoxide glucagon receptor, preventing its activation and subsequent signaling cascade. As a result, the antibody inhibits the nuclear translocation of specific antibodies involved in viral replication and immune evasion.</p>Hamster (CHO) GTP-binding Nuclear Protein (RAN) ELISA Kit
<p>Please enquire for more information about Hamster (CHO) GTP-binding Nuclear Protein (RAN) ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%HSV2 gC antibody
<p>HSV2 gC antibody was raised in mouse using herpes simplex virus II glycoprotein C (gC) as the immunogen.</p>SEK1 antibody
<p>SEK1 antibody is a highly specialized product used in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, offering researchers flexibility in their experiments. This antibody specifically targets glycopeptides, which are high polymers with glycosylation. It is commonly used for various applications, including the study of hormone peptides and intraocular processes.</p>Pureza:Min. 95%SR-4370
CAS:<p>SR-4370 is a potent inhibitor of the histone deacetylase (HDAC) enzyme class. It has been shown to inhibit cholesterol synthesis and lipid biosynthesis in cells, as well as inhibiting cancer cell proliferation. SR-4370 also has antioxidant effects, which may be due to its ability to inhibit the activation of NF-κB and downstream mediators. In addition, this compound has been shown to have synergistic effects with other HDAC inhibitors and chemotherapy drugs. This drug is being developed for the treatment of cancers such as prostate cancer, melanoma, breast cancer, colon cancer, and head and neck cancer.</p>Fórmula:C17H18F2N2OPureza:Min. 95%Peso molecular:304.33 g/molRef: 3D-RXC29467
Producto descatalogadoMouse Resistin ELISA kit
<p>ELISA kit for the detection of Mouse Resistin in the research laboratory</p>Pureza:Min. 95%Pig IgG ELISA Kit
<p>The Pig IgG ELISA kit is intended for the quantitative determination of total pig IgG in biological samples.</p>Pureza:Min. 95%05:0 PC
CAS:<p>05:0 PC is a peptide binding sequence that has been shown to inhibit the replication of viral sequences. 05:0 PC binds to the amino acid sequence in protein, which is a model system for peptide binding. The endoplasmic reticulum, or ER, is the site of synthesis for proteins and its low efficiency may be due to the spontaneous nature of the protein synthesis process. The ER can also be seen as an inhibitor molecule that prevents the virus from replicating. 05:0 PC has been shown to inhibit papillomavirus and HIV-1 replication in vitro. This peptide has also been shown to block interactions between viruses and cells that allow viral replication.</p>Fórmula:C18H36NO8PPureza:Min. 95%Peso molecular:425.45 g/molRef: 3D-RCA41434
Producto descatalogadoProlactin Releasing Peptide (1-31), bovine
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C157H244N54O41SPeso molecular:3,576.01 g/molAmyloid beta-Protein (36-38)
CAS:<p>Amyloid beta-Protein (36-38) is a peptide that has molecular weight of 4.3 kDa. It is a fragment of amyloid precursor protein, which is cleaved by enzymes in the brain to create the peptide. Amyloid beta-Protein (36-38) has been found to be involved in Alzheimer's disease as it aggregates into β-sheet bundles and forms amyloid plaques in the brain. This protein can be detected using vibrational spectroscopy and has been observed to have a strain that changes depending on pH. This molecule also undergoes proteolysis by peptidases, which break down proteins into amino acids for analysis with an amino acid analyzer. The solute can be analyzed with an acid analysis or spectrometer, which are used to determine functional groups such as carboxylic acids, hydroxyls, or amides. Amyloid beta-Protein (36-38)</p>Fórmula:C9H17N3O4Pureza:Min. 95%Peso molecular:231.25 g/molRef: 3D-FA109475
Producto descatalogadoMyelin Oligodendrocyte Glycoprotein (35-55) (mouse, rat) trifluoroacetate
CAS:<p>Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.</p>Fórmula:C118H177N35O29S•C2HO2F3Pureza:Min. 95%Forma y color:PowderPeso molecular:2,695.98 g/molRef: 3D-FM109206
Producto descatalogadoMesotocin trifluroacetate
CAS:<p>Mesotocin is a peptide hormone that has a role in the regulation of water permeability and estradiol benzoate. It also regulates the physiological functions of the brain and has been shown to be involved in congestive heart failure, as it causes an increase in blood pressure. Mesotocin is found at high levels in human serum, but its activity is dependent on the presence of other hormones such as estradiol benzoate. The biological properties of mesotocin are largely unknown, although it is known to have receptor activity. The effects of this hormone on the kidney have been studied using mesotocin trifluroacetate (MTFA) and monoclonal antibody (mAb). MTFA causes an increase in glomerular filtration rate (GFR), which may be due to its ability to inhibit angiotensin II-induced vasoconstriction and decrease vascular resistance.</p>Fórmula:C43H66N12O12S2Pureza:Min. 95%Peso molecular:1,007.19 g/molRef: 3D-FI108690
Producto descatalogadoHead activator
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C54H84N12O14Peso molecular:1,125.36 g/molCJC-1295
CAS:<p>CJC-1295 is a synthetic peptide, which is an analogue of growth hormone-releasing hormone (GHRH). It is synthesized through recombinant DNA technology, which allows for precise control over its sequence and length. This particular peptide is designed to bind to GHRH receptors in the pituitary gland. By activating these receptors, CJC-1295 stimulates the release of growth hormone (GH) into the bloodstream.The primary function of CJC-1295 is to influence the endocrine system, particularly enhancing the release of endogenous growth hormone. It achieves this by increasing the amplitude and frequency of GH pulses without affecting the natural negative feedback mechanisms that regulate GH production. This mode of action distinguishes CJC-1295 from other growth hormone therapies, as it promotes a more physiological pattern of hormone secretion.CJC-1295 is used in various scientific contexts, primarily in research focusing on growth hormone deficiencies, muscle wasting conditions, and certain metabolic disorders. Its ability to increase GH release also makes it a subject of interest in studies related to aging, tissue repair, and regeneration. The longer half-life of CJC-1295 compared to natural GHRH peptides further enhances its applications in research, allowing for more sustained and controlled experimentation.</p>Pureza:Min. 95%Ref: 3D-FC138107
Producto descatalogado[Ala81]-MBP (74-85)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C55H94N20O21Peso molecular:1,371.48 g/molH-His-Arg-OH
CAS:<p>H-His-Arg-OH is a synthetic peptide that has been shown to have cytotoxic effects on mammalian cells. The H-His-Arg-OH peptide can be used for the treatment of heart disease and autoimmune diseases, such as rheumatoid arthritis. This peptide has been found to be resistant to congestive heart failure, which is caused by a number of factors, including hypertension and valvular stenosis. It has also been shown to have an immunoglobulin G1 (IgG1) genotype.</p>Fórmula:C12H21N7O3Pureza:Min. 95%Peso molecular:311.34 g/molRef: 3D-FH108062
Producto descatalogado
