Compuestos y reactivos bioquímicos

<p>The DHFR antibody is a highly specialized monoclonal antibody used in Life Sciences research. It plays a crucial role in various proteolytic processes and is commonly used in immunoassays to detect and quantify the presence of DHFR protein. This antibody specifically targets and binds to the DHFR enzyme, inhibiting its activity and preventing the conversion of dihydrofolate to tetrahydrofolate. By doing so, it disrupts essential cellular processes such as DNA synthesis, repair, and methylation. The DHFR antibody has also been shown to activate the p38 mitogen-activated protein kinase pathway and induce endonuclease activity in certain cell types. Its acidic nature allows for efficient penetration into cells and binding to nuclear factor kappa-light-chain-enhancer of activated B cells (NF-κB) transcription factors, influencing gene expression patterns. Researchers rely on the high specificity and sensitivity of this monoclonal antibody for accurate analysis of DHFR-related pathways and understanding its role in growth regulation</p>

<p>Goat anti-mouse IgG (Fab'2) (PE) was raised in goat using murine IgG F(ab’)2 fragment as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAPK13 antibody, catalog no. 70R-5668</p>

<p>The GAPDH Blocking Peptide is a powerful tool used in Life Sciences research. It is a ligase that acts as a blocking peptide for glyceraldehyde-3-phosphate dehydrogenase (GAPDH). This peptide specifically inhibits the activity of GAPDH, an essential enzyme involved in glycolysis and other cellular processes. By blocking the function of GAPDH, researchers can study the impact of its inhibition on various cellular pathways and processes. The GAPDH Blocking Peptide is widely used in biochemical and molecular biology studies, providing valuable insights into the role of this enzyme in cellular functions. With its high quality and effectiveness, this peptide is a valuable addition to any research project in the field of Life Sciences.</p>

<p>The RLBP1 antibody is a monoclonal antibody that targets RLBP1, a protein involved in the regulation of microvessel density. This antibody acts as an anticoagulant by binding to RLBP1 and inhibiting its function. It has been shown to reduce fibrinogen levels and inhibit the production of acidic TNF-α, a growth factor involved in inflammation. Additionally, the RLBP1 antibody has been found to have multidrug properties, as it can bind to and neutralize the effects of various antibodies such as adalimumab. Its mechanism of action involves targeting activated nuclear receptors and modulating their activity. With its unique characteristics, the RLBP1 antibody offers potential therapeutic applications in the field of vascular biology and inflammation research.</p>

<p>LRRC66 antibody was raised using the middle region of LRRC66 corresponding to a region with amino acids NVTFQTIPGKCKNQEDPFEKPLISAPDSGMYKTHLENASDTDRSEGLSPW</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRIP6 antibody, catalog no. 70R-9086</p>

<p>The Caspase 2 antibody is a cytotoxic monoclonal antibody that targets the Caspase 2 protein. This antibody has been shown to have significant growth factor inhibitory effects and can be used in various research applications. It specifically binds to the Caspase 2 protein, which plays a critical role in apoptosis, or programmed cell death. The antibody can be used for immunohistochemistry, immunofluorescence, and Western blotting experiments to study the expression and localization of Caspase 2 in different tissues and cell types. Additionally, it has been successfully used in combination with other antibodies, such as anti-CD33 antibodies or trastuzumab, to enhance their cytotoxic effects. This highly specific antibody recognizes both native and denatured forms of the Caspase 2 protein and is suitable for use with human serum samples. Its high affinity for Caspase 2 ensures accurate detection and reliable results in Life Sciences research.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KLHDC8B antibody, catalog no. 70R-3670</p>

<p>Purified recombinant Human PFDN6 protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CRLF1 antibody, catalog no. 70R-5737</p>

<p>Purified recombinant Human NKIRAS1 protein (His tag)</p>

<p>POLG2 antibody was raised in rabbit using the N terminal of POLG2 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal GLYATL1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Ttbk2 antibody, catalog no. 70R-8045</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C3orf24 antibody, catalog no. 70R-3887</p>

<p>FAM71D antibody was raised using the middle region of FAM71D corresponding to a region with amino acids VTVVFENNDLIRAKQEEKEKLKNILKPGCLQDTKSKSELKESSKHVTISN</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DDX50 antibody, catalog no. 70R-1367</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ECHDC2 antibody, catalog no. 70R-5270</p>

Purified recombinant Human SULT1B1 Protein (His tag)

<p>human IgE from myelomatous human serum.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BLVRB antibody, catalog no. 70R-2179</p>

<p>INSR antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SDF4 antibody, catalog no. 70R-7410</p>

<p>DGAT2L4 antibody was raised using the C terminal of DGAT2L4 corresponding to a region with amino acids GEPLPMPKIENPSQEIVAKYHTLYIDALRKLFDQHKTKFGISETQELEII</p>

<p>Rabbit polyclonal Ubinuclein antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RNF182 antibody, catalog no. 70R-6668</p>

<p>Purified recombinant IMMP2L protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TSPAN32 antibody, catalog no. 70R-1884</p>

MRPL3 antibody was raised in Rabbit using Human MRPL3 as the immunogen

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PDE1A antibody, catalog no. 70R-9236</p>

<p>ACTB antibody was raised in Rabbit using Human ACTB as the immunogen</p>

<p>Rabbit polyclonal ALOX5 antibody</p>

<p>WNT6 antibody was raised using the middle region of WNT6 corresponding to a region with amino acids ERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTG</p>

<p>HSDL1 antibody was raised in Rabbit using Human HSDL1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FBXW8 antibody, catalog no. 70R-9336</p>

<p>Fibrinopeptide A antibody was raised in mouse using Fibrinopeptide A conjugated with carrier protein as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FARS2 antibody, catalog no. 70R-1396</p>

<p>Mouse monoclonal CD3 antibody (PE)</p>

<p>Rabbit polyclonal AGP1 antibody</p>

<p>Mouse monoclonal NIT1 antibody</p>

<p>ASS1 antibody was raised using the N terminal Of Ass corresponding to a region with amino acids YSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVF</p>

<p>ADAMTSL4 antibody was raised in Rabbit using Human ADAMTSL4 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MFAP1 antibody, catalog no. 70R-4332</p>

<p>Affinity purified Rabbit polyclonal CSDE1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ARL3 antibody, catalog no. 70R-9841</p>

Transferrin protein is a highly versatile and essential component found in human serum. It plays a crucial role in iron homeostasis, as it binds to iron and transports it throughout the body. This activated protein has been used as a medicament for various purposes, including the treatment of iron deficiency anemia.

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C22orf9 antibody, catalog no. 70R-3145</p>

<p>IL16 antibody is a highly effective polyclonal antibody that specifically targets IL16, a cytokine involved in immune response regulation. This antibody recognizes and binds to the amino group of IL16, neutralizing its activity and preventing it from interacting with its receptors. The IL16 antibody can be used in various research applications, including immunohistochemistry, Western blotting, and flow cytometry. It has been shown to inhibit the growth and proliferation of mesenchymal stem cells and has potential therapeutic applications in cancer treatment. Additionally, this antibody has been used as a tool in studying the role of IL16 in diseases such as asthma, rheumatoid arthritis, and HIV infection. With its high specificity and effectiveness, the IL16 antibody is a valuable tool for researchers in the life sciences field.</p>

<p>Goat anti-human lambda chain (Rhodamine) was raised in goat using human lambda light chain as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF499 antibody, catalog no. 70R-7819</p>

Region of PIGF1 protein corresponding to amino acids MLPAVPPQQW ALSAGNGSSE VEVVPFQEVW GRSYCRALER LVDVVSEYPS EVEHMFSPSC VSLLRCTGCC GDENLHCVPV ETANVTMQLL KIRSGDRPSY VELTFSQHVR CECRPLREKM KPERCGDAVP RR.

<p>DUSP4 antibody was raised in Rabbit using Human DUSP4 as the immunogen</p>

<p>The uPAR antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets the urokinase plasminogen activator receptor (uPAR), which plays a crucial role in various biological processes such as cell adhesion, migration, and invasion. The uPAR antibody binds to the glycopeptide domain of uPAR, inhibiting its function and preventing the activation of downstream signaling pathways.</p>

<p>CARS antibody was raised using the N terminal of CARS corresponding to a region with amino acids MQTPPLQQPHQEQVFLAFLVIVIPSFLTKEVFIPQDGKKVTWYCCGPTVY</p>

<p>The SDS antibody is a highly specialized product used in the field of Life Sciences. It is an antibody specifically designed to target and detect insulin, a hormone crucial for regulating blood sugar levels. This monoclonal antibody has been extensively tested and validated for its specificity and sensitivity in various research applications.</p>

<p>The Focal Adhesion Kinase antibody is a highly specialized antibody used in Life Sciences research. It plays a crucial role in endothelial growth and has been extensively studied for its involvement in various cellular processes. This monoclonal antibody specifically targets the tyrosine residues of Focal Adhesion Kinase, inhibiting its activity and preventing downstream signaling events.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FBP2 antibody, catalog no. 70R-3380</p>

<p>Rabbit polyclonal OR3A2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PCDH21 antibody, catalog no. 70R-8861</p>

<p>BXDC1 antibody was raised in Rabbit using Human BXDC1 as the immunogen</p>

<p>The Serpin B5 antibody is a glycoprotein that belongs to the family of Polyclonal Antibodies. It is widely used in Life Sciences as an inhibitor of various proteins and enzymes. This antibody specifically targets Serpin B5, also known as Maspin, which plays a crucial role in tumor suppression and metastasis. The immobilized Serpin B5 antibody can be used for various applications, including Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assay (ELISA). It is also compatible with other antibodies, such as anti-CD20 antibodies or monoclonal antibodies, allowing for versatile experimental designs. Whether you are studying protein-protein interactions or developing antibody-drug conjugates, the Serpin B5 antibody is an essential tool in your research arsenal.</p>

NDUFAF1 antibody was raised in Rabbit using Human NDUFAF1 as the immunogen

<p>LIMA1 antibody was raised in Rabbit using Human LIMA1 as the immunogen</p>

<p>The NF kappaB p65 antibody is a highly specialized monoclonal antibody that specifically targets and neutralizes the activated form of NF kappaB p65. This antibody is colloidal in nature, allowing for easy dispersion and binding to its target. It has been extensively tested and proven to be cytotoxic to cells expressing high levels of NF kappaB p65, making it an ideal tool for research in the field of Life Sciences.</p>

<p>EIF2S2 antibody was raised using the N terminal of EIF2S2 corresponding to a region with amino acids DEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKD</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF237 antibody, catalog no. 20R-1087</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LUC7L antibody, catalog no. 70R-9549</p>

<p>C14orf94 antibody was raised in Rabbit using Human C14orf94 as the immunogen</p>

<p>Rabbit polyclonal SPRY3 antibody</p>

<p>The MEK1 antibody is a highly specialized antibody that targets the amyloid protein and is activated in the presence of this specific protein. It belongs to the class of anti-beta amyloid antibodies and has been extensively studied in the field of Life Sciences. This antibody has shown neuroprotective properties and has been found to neutralize the harmful effects of beta amyloid on brain cells.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CCDC110 antibody, catalog no. 70R-9333</p>

<p>The RNASE1 antibody is a monoclonal antibody that specifically targets and binds to RNASE1, an enzyme involved in the breakdown of RNA molecules. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research areas.</p>

<p>Purified recombinant Human TCEA1 Protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SFRS2 antibody, catalog no. 70R-10293</p>

<p>HRG1 beta antibody was raised in rabbit using highly pure recombinant human heregulin-beta1 as the immunogen.</p>

<p>Affinity purified Rabbit polyclonal TMED9 antibody</p>

<p>TMEM195 antibody was raised using the N terminal of TMEM195 corresponding to a region with amino acids VPDYVKKATPFFISLMLLELVVSWILKGKPPGRLDDALTSISAGVLSRLP</p>

<p>PDGFRB antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of STARD4 antibody, catalog no. 70R-9193</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of STOML2 antibody, catalog no. 70R-10371</p>

<p>ATAD1 antibody was raised in rabbit using the C terminal of ATAD1 as the immunogen</p>

<p>Purified recombinant FBXO6 protein (His tag)</p>

<p>The NTRK2 antibody is a highly specialized protein that plays a crucial role in the field of Life Sciences. It is an antibody that specifically targets and binds to the NTRK2 protein, which is involved in various cellular processes. This polyclonal antibody can be used for research purposes, such as studying the function and expression of NTRK2 in different cell types and tissues.</p>

<p>Mouse monoclonal MRPS2 antibody</p>

<p>Region of MIP3 alpha protein corresponding to amino acids ASNYDCCLSY IQTPLPSRAI VGFTRQMADE ACDINAIIFH TKKRKSVCAD PKQNWVKRAV NLLSLRVKKM.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PRR13 antibody, catalog no. 70R-3720</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC1A4 antibody, catalog no. 70R-6961</p>

<p>MYH14 antibody was raised in Rabbit using Human MYH14 as the immunogen</p>

<p>The RAMP2 antibody is a highly specialized monoclonal antibody that has a wide range of applications in the field of Life Sciences. It has been extensively studied for its ability to inhibit the activity of hydrogen fluoride, glucose-6-phosphate, and other test compounds. This antibody is known for its exceptional binding affinity to specific polymers and can be used as a powerful tool in various research studies.</p>

<p>FLYWCH1 antibody was raised in rabbit using the C terminal of FLYWCH1 as the immunogen</p>

<p>Purified Rabbit polyclonal FGFR1 antibody (Tyr766)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. Through its unique mechanism of action, it binds to DNA-dependent RNA polymerase, preventing transcription and replication, ultimately inhibiting bacterial growth. This drug has been extensively studied using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique. Additionally, it undergoes various metabolic transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers highly expressed in Mycobacterium tuberculosis strains and effectively inhibits their cell growth in culture</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Pcdh11x antibody, catalog no. 70R-8668</p>

<p>Rabbit polyclonal NDUFA1 antibody</p>

<p>Rabbit polyclonal NFKB p100 antibody</p>

<p>Lp-PLA2 antibody is a powerful tool in the field of Life Sciences. It specifically targets lipoprotein-associated phospholipase A2 (Lp-PLA2), an enzyme that plays a crucial role in the metabolism of fatty acids. By inhibiting Lp-PLA2, this antibody helps regulate chemokine levels, reducing inflammation and improving overall vascular health.</p>

<p>Selenoprotein antibody was raised using the middle region of 15 kDa Selenoprotein corresponding to a region with amino acids SDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLS</p>

<p>PPP1R8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKK</p>

<p>1-217 amino acids: MSKPPPKPVK PGEGGQVKVF RALYTFEPRT PDELYFEEGD IIYITDMSDT NWWKGTSKGR TGLIPSNYVA EQAESIDNPL HEAAKRGNLS WLRECLDNRV GVNGLDKAGS TALYWACHGG HKDIVEMLFT QPNIELNQQN KLGDTALHAA AWKGYADIVQ LFLAKGARTD LRNIEKKLAF DMATNAACAS LLKKKQGTDA VRTLSNAEDY LDDEDSDLEH HHHHH</p>

Mouse monoclonal CD229 antibody (allophycocyanin)

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC38A3 antibody, catalog no. 70R-7037</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCNC1 antibody, catalog no. 70R-1810</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CPA1 antibody, catalog no. 70R-5489</p>

<p>Mouse monoclonal Aeromonas caviae antibody</p>

<p>Recombinant Human IGFBP3 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAPT antibody, catalog no. 70R-6021</p>

<p>The IDS antibody is a specific antibody widely used in Life Sciences research. It is commonly used for the detection and analysis of various proteins, including those involved in cellular signaling pathways, gene expression, and disease biomarkers. The IDS antibody has been extensively validated and is known for its high specificity and sensitivity.</p>

<p>ORAI1 antibody was raised using the middle region of ORAI1 corresponding to a region with amino acids IGTLLFLAEVVLLCWVKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITP</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AKAP7 antibody, catalog no. 70R-1065</p>

<p>The WFDC2 antibody is a highly specialized monoclonal antibody that targets specific molecules involved in various biological processes. It has been extensively studied in the field of life sciences and has shown great potential in different applications.</p>

<p>JMJD1B antibody was raised in rabbit using the C terminal of JMJD1B as the immunogen</p>

<p>HRH1 antibody was raised in Rabbit using Human HRH1 as the immunogen</p>

<p>TNF alpha antibody was raised in goat using highly pure recombinant human TNF-alpha as the immunogen.</p>

<p>Rabbit polyclonal TLR2 antibody (N-terminal)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Ssr2 antibody, catalog no. 70R-8627</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SSR1 antibody, catalog no. 70R-7311</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Zc3h3 antibody, catalog no. 70R-9310</p>

<p>The PFKP antibody is a powerful tool used in the field of Life Sciences. It is a polyclonal antibody that specifically targets and neutralizes PFKP, an enzyme involved in the glycolysis pathway. This antibody has been extensively studied for its role in various cellular processes, including chemokine production, histidine metabolism, and TGF-beta signaling. Additionally, the PFKP antibody has shown promising results in promoting endothelial growth and inhibiting angiogenesis, making it a valuable asset in cancer research. Furthermore, this antibody has been found to have potential therapeutic applications in neurodegenerative diseases such as Alzheimer's, as it can bind to amyloid plaques and reduce their formation. With its high specificity and low-molecular-weight characteristics, the PFKP antibody is an essential tool for researchers looking to unravel the intricate mechanisms of cellular processes and develop innovative treatments for various diseases.</p>

<p>Affinity purified Rabbit polyclonal TCF19 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UMPS antibody, catalog no. 70R-2670</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PSMB2 antibody, catalog no. 70R-2347</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GPR87 antibody, catalog no. 70R-3377</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ING3 antibody, catalog no. 70R-2097</p>

<p>Rabbit polyclonal RGS3 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF707 antibody, catalog no. 70R-8450</p>

<p>CA5A antibody was raised in rabbit using the C terminal of CA5A as the immunogen</p>

<p>Purified Polyclonal PRPF19 antibody</p>

<p>The CYP1A2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It acts as a cross-linking agent and is commonly used in colloidal assays to detect the presence of specific proteins, such as TNF-α. This antibody has been extensively studied and has shown high affinity for its target antigen, making it a valuable tool in various research applications.</p>

<p>Affinity purified Rabbit polyclonal FUS2 antibody</p>

<p>ACP5 antibody was raised in Rabbit using Human ACP5 as the immunogen</p>

<p>Donkey anti-mouse IgG (H + L) (biotin) was raised in donkey using mouse IgG (H&amp;L) as the immunogen.</p>

<p>ZNF780A antibody was raised in rabbit using the N terminal of ZNF780A as the immunogen</p>

<p>Rabbit polyclonal NAB2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC14A1 antibody, catalog no. 70R-7059</p>

<p>The Caspase 1 antibody is a highly specialized antibody that specifically targets and neutralizes the activated form of Caspase 1. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs.</p>

<p>EIF3D antibody was raised in Rabbit using Human EIF3D as the immunogen</p>

<p>Ndufv2 antibody was raised in rabbit using the C terminal of Ndufv2 as the immunogen</p>

<p>ApoH Matched Pair antibody Set for ELISA, B2GP1 ELISA kit, beta 2 glycoprotein ELISA kit, BG ELISA kit, Apolipoprotein H ELISA kit, Apo H ELISA kit, Apo-H ELISA kit, B2G1 ELISA kit</p>

<p>CD45 antibody (Azide free) was raised in Rat using CD45/LCA as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAFK antibody, catalog no. 20R-1260</p>

<p>The BM40 protein is a crucial component involved in various biological processes. It interacts with β-catenin and plays a significant role in cell signaling pathways. This protein has been extensively studied for its potential therapeutic applications.</p>

<p>Purified recombinant Human TAC1 protein (His tag)</p>

<p>MLX antibody was raised in Rabbit using Human MLX as the immunogen</p>

<p>The PNMT antibody is a high-quality, buffered monoclonal antibody that is used in various assays and research applications. It specifically targets the enzyme phenylethanolamine N-methyltransferase (PNMT) and has been proven to be highly reactive and specific in detecting PNMT in human serum samples. This antibody is commonly used in studies related to fibrinogen, mesenchymal stem cells, and protein carbonyls. Additionally, it can be immobilized on an electrode for use in electrode-based assays.</p>

<p>RanBP3 antibody was raised using the N terminal of RANBP3 corresponding to a region with amino acids MADLANEEKPAIAPPVFVFQKDKGQKSPAEQKNLSDSGEEPRGEAEAPHH</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ANXA1 antibody, catalog no. 70R-1703</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM146 antibody, catalog no. 70R-7055</p>

<p>Rabbit polyclonal GAB4 antibody</p>

<p>Mouse monoclonal IFI35 antibody</p>

<p>The ANGPTL4 antibody is a powerful tool in the field of life sciences. It is a monoclonal antibody that specifically targets and neutralizes ANGPTL4, a human enzyme involved in plasma lipoprotein metabolism. This antibody can be used for various applications such as collagen polymerase chain reaction (PCR) hybridization, studying the role of ANGPTL4 in plasma lipoprotein regulation, and developing new therapeutic strategies for metabolic disorders.</p>

<p>Slc9a5 antibody was raised in rabbit using the C terminal of Slc9a5 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal DRAK1 antibody</p>

A synthetic peptide for use as a blocking control in assays to test for specificity of DAZ4 antibody, catalog no. 70R-4895

<p>The Androgen Receptor Antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that has been specifically designed to target and bind to the androgen receptor, a key protein involved in various biological processes. This antibody is activated upon binding to the receptor, allowing for further investigation and analysis.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LRCH4 antibody, catalog no. 70R-7117</p>

<p>The Podoplanin antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets and binds to the glial fibrillary acidic protein (GFAP), which is predominantly found in astrocytes. This antibody plays a crucial role in studying the function and behavior of astrocytes, as well as their involvement in various neurological disorders.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF385 antibody, catalog no. 70R-7881</p>

<p>The PKD2 antibody is a polyclonal antibody used in life sciences research. It is commonly used to detect and study the protein PKD2, which plays a crucial role in cell signaling pathways. This antibody can be used in various applications such as immunohistochemistry, western blotting, and flow cytometry.</p>

<p>PFDN6 antibody was raised using the N terminal of PFDN6 corresponding to a region with amino acids MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALL</p>

<p>Recombinant human TCEB1 protein (His tag)</p>

<p>DHRS9 antibody was raised in Rabbit using Human DHRS9 as the immunogen</p>

<p>Endothelin A receptor antibody was raised in sheep using C-terminal peptide QEQNHNTERSSHK residues 410 - 422 of rat ET(A) Receptor conjugated to KLH as the immunogen.</p>

<p>Affinity purified Rabbit polyclonal ZNF7 antibody</p>

<p>TCFAP2C antibody was raised in rabbit using the N terminal of TCFAP2C as the immunogen</p>

<p>Rabbit polyclonal NQO2 antibody</p>

<p>The GAP43 antibody is a highly specialized monoclonal antibody that is used in various research applications. It is commonly used as an electrode inhibitor and has been shown to be effective in immobilizing specific proteins for further analysis. This antibody is also useful in the field of diuretic research, where it has been shown to have a reactive effect on human serum. Additionally, the GAP43 antibody has demonstrated neutralizing properties against interleukin-6, making it a valuable tool in immunological studies. Furthermore, this antibody has been found to be effective in the study of mesenchymal stem cells and their reactive oxygen species production. With its wide range of applications and proven effectiveness, the GAP43 antibody is a valuable asset for any researcher in need of reliable and accurate results.</p>

<p>Purified Rabbit polyclonal OR56A3 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GRK4 antibody, catalog no. 70R-9232</p>

<p>Affinity purified Rabbit polyclonal Meckelin isoform 1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of COIL antibody, catalog no. 70R-2429</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NLGN4X antibody, catalog no. 70R-6163</p>

<p>Purified recombinant SYCE3 protein (His tag)</p>

<p>Purified recombinant Human PDXP protein</p>

<p>Purified recombinant TIMM8A protein (His tag)</p>

<p>Purified Polyclonal PMS1 antibody</p>

<p>Conjugated Estriol 3 CMEr-HRP hapten</p>

<p>CD86 antibody (Azide free) was raised in rat using murine CD86 as the immunoge.</p>

<p>SMYD2 antibody was raised in rabbit using the middle region of SMYD2 as the immunogen</p>

<p>The SUZ12 antibody is a high-quality polyclonal antibody that is widely used in the field of life sciences. It is also available as a monoclonal antibody, providing researchers with options for their specific needs. This antibody has been extensively tested and proven to be effective in various applications.</p>