Compuestos y reactivos bioquímicos

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SH3BGR antibody, catalog no. 70R-1963</p>

<p>The STAT5A antibody is a powerful tool in the field of life sciences. It is a metallic, monoclonal antibody that specifically targets and neutralizes STAT5A, an important protein involved in endothelial growth and various cellular processes. This antibody has been extensively studied and proven to be effective in blocking the activity of STAT5A, thereby inhibiting the growth factor signaling pathways associated with it.</p>

<p>The LKB1 antibody is a monoclonal antibody that specifically targets the growth hormone receptor. It is commonly used in Life Sciences research to study the role of this receptor in various cellular processes. The LKB1 antibody binds to the antigen on the growth hormone receptor, blocking its activity and preventing downstream signaling events. This antibody can be used in experiments to investigate the effects of inhibiting the growth hormone receptor, such as studying cell proliferation, differentiation, and survival. Additionally, the LKB1 antibody can be used in combination with other antibodies or inhibitors to explore potential therapeutic applications. With its high specificity and affinity for the target protein, the LKB1 antibody is a valuable tool for researchers in the field of molecular biology and drug discovery.</p>

<p>The SSB antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to neutralize specific inhibitors and has been extensively studied for its therapeutic potential. This antibody exhibits unique characteristics including acid modifications, glycosylation, and globulin structure, which contribute to its high specificity and efficacy.</p>

<p>MAGEB2 antibody was raised using the N terminal of MAGEB2 corresponding to a region with amino acids MPRGQKSKLRAREKRRKARDETRGLNVPQVTEAEEEEAPCCSSSVSGGAA</p>

<p>Endostatin antibody was raised in rabbit using highly pure recombinant human endostatin as the immunogen.</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

<p>Rabbit polyclonal SERINC2 antibody</p>

<p>BIRC7 antibody was raised in rabbit using the middle region of BIRC7 as the immunogen</p>

<p>Human IgE is a hormone peptide that plays a crucial role in immune response and allergic reactions. It is a protein that belongs to the immunoglobulin family and is involved in the activation of various immune cells. Human IgE specifically recognizes and binds to antigens, triggering an immune response against them. Monoclonal antibodies targeting human IgE have been developed for therapeutic purposes. These antibodies can neutralize the effects of IgE, reducing allergic reactions and symptoms associated with allergies such as asthma, hay fever, and hives. They work by blocking the binding of IgE to its receptors on immune cells, preventing the release of inflammatory mediators. In addition to their therapeutic applications, human IgE and its monoclonal antibodies are widely used in research and diagnostic laboratories. They are valuable tools for studying immune responses, identifying specific allergens, and detecting the presence of autoantibodies or infections caused by microorganisms like Mycoplasma genitalium. Our purified human IgE products are carefully</p>

<p>Purified Polyclonal Cathepsin D HC antibody</p>

<p>Rabbit polyclonal MSK1 antibody</p>

<p>LHPP antibody was raised using the middle region of LHPP corresponding to a region with amino acids ACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGM</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FSCN3 antibody, catalog no. 70R-9247</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NSMCE1 antibody, catalog no. 70R-1645</p>

<p>The TAP1 antibody is a highly specialized antibody that plays a crucial role in the immune system. It is known for its catalase activity, which helps to neutralize harmful substances in the body. This polyclonal antibody has been extensively studied in the field of Life Sciences and has shown great potential as a therapeutic agent.</p>

<p>Rabbit polyclonal PP1 alpha antibody</p>

<p>The AIMP1 antibody is a monoclonal antibody that targets TNF-related apoptosis-inducing protein (TRAIL). It is commonly used in life sciences research and has applications in various fields. The AIMP1 antibody specifically binds to TNF-α, a cytokine involved in inflammation and cell death processes. By targeting TNF-α, the AIMP1 antibody can modulate apoptosis, making it a valuable tool for studying cell signaling pathways and exploring potential therapeutic interventions.</p>

<p>SNAI2 antibody was raised in Mouse using a purified recombinant fragment of human SNAI2 expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal TM16G antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FLJ35767 antibody, catalog no. 70R-4288</p>

<p>Mouse monoclonal HMOX2 antibody</p>

<p>ATG16L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAA</p>

<p>The Adiponectin antibody is a highly specialized antibody used in Life Sciences research. It is designed to specifically target and bind to adiponectin, a hormone involved in various physiological processes such as metabolism and inflammation. This antibody has been extensively tested and validated for its specificity and sensitivity in various assays.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a potent antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it exhibits strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth. The efficacy of this drug has been demonstrated through extensive research using advanced techniques like patch-clamp technique on human erythrocytes.</p>

<p>Purified recombinant Human TXNRD1 protein</p>

<p>Mouse monoclonal CKMT1A antibody</p>

<p>CXCL5 antibody was raised in Rabbit using Human CXCL5 as the immunogen</p>

<p>The INHA Antibody is a highly specialized monoclonal antibody that targets the superoxide enzyme. It has been extensively studied and proven to have a wide range of applications in various fields, including Life Sciences. This antibody specifically binds to superoxide and can be used for research purposes such as studying its role in oxidative stress, inflammation, and cell signaling pathways.</p>

<p>LPP antibody was raised in Mouse using a purified recombinant fragment of human LPP expressed in E. coli as the immunogen.</p>

<p>The IRF3 antibody is a highly effective monoclonal antibody that is used in the field of Life Sciences. This colloidal antibody has neutralizing properties and targets the serine protease, which plays a crucial role in various biological processes. It can be used in solid phase assays to detect and quantify IRF3 protein levels. The IRF3 antibody also acts as an inhibitor, preventing the antigen-antibody reaction from occurring and thereby inhibiting cytotoxic effects. With its specificity and high affinity, this antibody is an essential tool for researchers in the field of Life Sciences.</p>

<p>Rabbit polyclonal Galectin 7 antibody</p>

<p>Rabbit polyclonal PPP1R12B antibody</p>

<p>Purified Rabbit polyclonal BCLAF1 antibody</p>

<p>The Osteoprotegerin antibody is a polyclonal antibody that targets the glycoprotein Osteoprotegerin. This antibody is widely used in Life Sciences research to study various biological processes, including bone metabolism, cell proliferation, and apoptosis. Osteoprotegerin acts as a decoy receptor for RANKL (Receptor Activator of Nuclear Factor Kappa-B Ligand), preventing its binding to RANK (Receptor Activator of Nuclear Factor Kappa-B) and thus inhibiting osteoclastogenesis and bone resorption.</p>

<p>Rabbit polyclonal SLC24A4 antibody</p>

<p>BRF2 antibody was raised in Rabbit using Human BRF2 as the immunogen</p>

<p>Purified Polyclonal CCDC102B antibody</p>

<p>The Paxillin antibody is a highly specific monoclonal antibody that is used in Life Sciences research. It is designed to target and bind to the paxillin protein, which plays a crucial role in cell adhesion and migration. This antibody can be used in various applications such as immunofluorescence, immunohistochemistry, and western blotting.</p>

<p>ZHX2 antibody was raised in rabbit using the C terminal of ZHX2 as the immunogen</p>

<p>Purified Rabbit polyclonal HUCE1 antibody</p>

<p>Rabbit Polyclonal Fyn antibody (Tyr530)</p>

<p>Rabbit polyclonal SIRPB1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACTN2 antibody, catalog no. 20R-1159</p>

<p>The YBX1 antibody is a highly specialized diagnostic reagent used in the field of Life Sciences. It is an antibody that specifically targets the YBX1 protein, which plays a crucial role in various cellular functions including protein-protein interactions and regulation of gene expression. This antibody can be used in flow immunoassays to detect the presence of YBX1 in human serum or other biological samples.</p>

<p>Region of PF4 protein corresponding to amino acids EAEEDGDLQC LCVKTTSQVR PRHITSLEVI KAGPHCPTAQ LIATLKNGRK ICLDLQAPLY KKIIKKLLES.</p>

<p>SLC7A11 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal NMUR1 antibody</p>

<p>The SETDB1 antibody is a monoclonal antibody that specifically targets and inhibits the function of SETDB1, a protein involved in epigenetic regulation. This antibody has been extensively studied in the field of life sciences and has shown promising results in various research applications. It has been found to effectively block the activity of SETDB1, which plays a crucial role in regulating gene expression and chromatin structure. By targeting SETDB1, this antibody can modulate important cellular processes such as cell growth, differentiation, and apoptosis. Additionally, the SETDB1 antibody has been used in studies investigating its potential as a therapeutic target for various diseases, including cancer. Its ability to interfere with the function of SETDB1 makes it a valuable tool for researchers studying epigenetic mechanisms and exploring new treatment strategies.</p>

<p>The PARK7 antibody is a highly specialized product used in Life Sciences research. It is an antibody that specifically targets the PARK7 protein, also known as DJ-1, which plays a critical role in cellular functions such as epidermal growth factor signaling and insulin secretion. This monoclonal antibody recognizes and binds to the amino group of the PARK7 protein, allowing for its detection and analysis.</p>

<p>Rabbit polyclonal TNNI3 antibody</p>

<p>Mouse monoclonal LIPG antibody</p>

<p>GABARAPL2 antibody was raised in Rabbit using Human GABARAPL2 as the immunogen</p>

<p>Rabbit polyclonal OR5AK3P antibody</p>

<p>Purified recombinant Mouse IL12 protein</p>

<p>Sheep anti-rabbit IgG (H+L) (biotin) was raised in sheep using rabbit IgG whole molecule as the immunogen.</p>

<p>The GAPDH Blocking Peptide is a highly effective tool for blocking the activity of glyceraldehyde-3-phosphate dehydrogenase (GAPDH), a key enzyme involved in glycolysis. This peptide can be used in various applications, including spectrometric analysis, virus surface antigen detection, protein kinase assays, and immobilization studies. It is commonly used in conjunction with monoclonal antibodies to inhibit the binding of GAPDH to target molecules.</p>

<p>The TFAM antibody is a highly specific and versatile tool used in life sciences research. This polyclonal antibody is designed to target and detect the transcription factor A, mitochondrial (TFAM) protein. TFAM plays a crucial role in regulating mitochondrial DNA replication and transcription, making it an essential component in studying cellular processes related to energy production and metabolism.</p>

<p>PLAGL1 antibody was raised in rabbit using the N terminal of PLAGL1 as the immunogen</p>

<p>Cdc27 antibody was raised in Mouse using a purified recombinant fragment of human Cdc27 expressed in E. coli as the immunogen.</p>

<p>Purified recombinant Human CALN1 protein</p>

<p>Nitrazepam 7 Conjugate for use in immunoassays</p>

<p>Purified recombinant ADI1 protein (His tag)</p>

<p>GCSF antibody was raised in Mouse using recombinant human G-CSF as the immunogen.</p>

<p>CYP2U1 antibody was raised in rabbit using the middle region of CYP2U1 as the immunogen</p>

<p>Rabbit polyclonal LAMA1 antibody</p>

<p>The GAL1 antibody is a highly specialized antibody that targets hepatocyte growth and lipase activity. It belongs to the class of monoclonal antibodies in Life Sciences. This antibody specifically binds to lipoprotein lipase (LPL) and apoa-I, which are key players in lipid metabolism. By targeting these molecules, the GAL1 antibody can modulate lipid levels and potentially have an impact on cardiovascular health. Additionally, this antibody has shown potential as a growth factor for certain cell types, such as endothelial cells, through its interaction with the growth hormone receptor. The GAL1 antibody is available in both monoclonal and polyclonal forms, offering researchers different options for their specific needs.</p>

<p>Lipoprotein Lipase Monoclonal Antibody Biotin</p>

<p>Ubiquilin-Like antibody was raised using the middle region of UBQLNL corresponding to a region with amino acids LTQHPATRVIYNSSGGFSSNTSANDTLNKVNHTSKANTAMISTKGQSHIC</p>

<p>Purified Polyclonal Carbonic Anhydrase 5A antibody</p>

<p>SMU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KQTQPERYIHLENLLARSYFDPREAYPDGSSKEKRRAAIAQALAGEVSVV</p>

<p>20-315 amino acids: MGSSHHHHHH SSGLVPRGSH MKPTEKKDRV HHEPQLSDKV HNDAQSFDYD HDAFLGAEEA KTFDQLTPEE SKERLGKIVS KIDGDKDGFV TVDELKDWIK FAQKRWIYED VERQWKGHDL NEDGLVSWEE YKNATYGYVL DDPDPDDGFN YKQMMVRDER RFKMADKDGD LIATKEEFTA FLHPEEYDYM KDIVVQETME DIDKNADGFI DLEEYIGDMY SHDGNTDEPE WVKTEREQFV EFRDKNRDGK MDKEETKDWI LPSDYDHAEA EARHLVYESD QNKDGKLTKE EIVDKYDLFV GSQATDFGEA LVRHDEF</p>

<p>The p90RSK antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and bind to p90RSK, a serine/threonine kinase that plays a crucial role in various cellular processes such as cell growth, proliferation, and survival. This antibody can be used in experiments involving nuclear extracts or immunohistochemistry to study the expression and localization of p90RSK.</p>

<p>The MEK5 antibody is a highly specialized product used in the field of Life Sciences. It is an antibody that specifically targets and binds to the MEK5 protein, which plays a crucial role in granulosa cell growth and development. This antibody can be used in various research applications, including immunohistochemistry, western blotting, and ELISA.</p>

<p>TRPM3 antibody was raised using the N terminal of TRPM3 corresponding to a region with amino acids ALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQD</p>

<p>SMPD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RQKLSPTYPAAHHFRSGIIGSGLCVFSKHPIQELTQHIYTLNGYPYMIHH</p>

<p>BRS3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of App antibody, catalog no. 70R-9609</p>

<p>FAM117B antibody was raised in Rabbit using Human FAM117B as the immunogen</p>

<p>Antithrombin III antibody (biotin) was raised in sheep using human antithrombin purified from plasma as the immunogen.</p>

<p>Rabbit polyclonal Cyclin C antibody (Ser275)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PPAPDC1B antibody, catalog no. 70R-6708</p>

<p>Mouse monoclonal CP4 EPSPS antibody</p>

<p>ISL2 antibody was raised in rabbit using the C terminal of ISL2 as the immunogen</p>

<p>PYGO1 antibody was raised in rabbit using the N terminal of PYGO1 as the immunogen</p>

<p>ZFP91 antibody was raised in rabbit using the N terminal of ZFP91 as the immunogen</p>

<p>Purified recombinant Human SNRPD2 protein</p>

<p>The CDK2 antibody is a powerful tool in the field of Life Sciences. It is a cytotoxic antibody that specifically targets the CDK2 molecule, which plays a crucial role in cell cycle regulation and proliferation. This antibody can be used in various applications, including immunohistochemistry, western blotting, and flow cytometry.</p>

<p>EGFL7 antibody was raised in Rabbit using Human EGFL7 as the immunogen</p>

<p>The BTK antibody is a powerful tool in the field of Life Sciences. It targets the Bruton's tyrosine kinase (BTK), which plays a crucial role in various cellular processes. This antibody can be used for research purposes, such as studying the effects of BTK inhibition on cell signaling pathways and protein kinase activity.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IFIT5 antibody, catalog no. 70R-5820</p>

<p>ADARB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NMSSSSTDVKENRNLDNVSPKDGSTPGPGEGSQLSNGGGGGPGRKRPLEE</p>

<p>Cryptochrome 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDE</p>

<p>CETN2 antibody was raised in Rabbit using Human CETN2 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal NR0B2 antibody</p>

<p>Sulphathiazole Conjugate for use in immunoassays</p>

<p>The TACC3 antibody is a highly specialized monoclonal antibody that is designed to target and bind to the TACC3 protein. This protein plays a crucial role in cell division and has been found to be overexpressed in various types of cancer, making it an important target for cancer research and treatment.</p>

<p>Rabbit polyclonal PPP2CB antibody (biotin)</p>

<p>TNIP1 antibody was raised in rabbit using the N terminal of TNIP1 as the immunogen</p>

<p>NUFIP2 antibody was raised in rabbit using the N terminal of NUFIP2 as the immunogen</p>

<p>Rabbit polyclonal POP7 antibody</p>

<p>PRPF38A antibody was raised in rabbit using the C terminal of PRPF38A as the immunogen</p>

<p>FLJ25791 antibody was raised using the middle region of Flj25791 corresponding to a region with amino acids EYTRKKYKKKMEQFMESCELITYLGAKMTRKYKEPQFRAIDFDHKLKTFL</p>

<p>DHX38 antibody was raised in mouse using recombinant Human Deah (Asp-Glu-Ala-His) Box Polypeptide 38 (Dhx38)</p>

<p>Rabbit polyclonal MED18 antibody</p>

<p>The CPVL antibody is a polyclonal antibody that is widely used in the field of life sciences. It specifically targets epidermal growth factor (EGF) and chemokine receptors, making it an essential tool for researchers studying these signaling pathways. In addition to its polyclonal form, monoclonal antibodies are also available for more specific applications.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DYSF antibody, catalog no. 70R-6699</p>

<p>COX16 antibody was raised in Rabbit using Human COX16 as the immunogen</p>

<p>MSRB2 antibody was raised in Rabbit using Human MSRB2 as the immunogen</p>

<p>Purified recombinant MOCS2 protein (His tag)</p>

<p>Purified Polyclonal GPR52 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of YIPF2 antibody, catalog no. 70R-8830</p>

<p>Affinity purified Rabbit polyclonal PDE4B antibody</p>

<p>SERPINA5 antibody was raised using the C terminal of SERPINA5 corresponding to a region with amino acids LPSEGKMQQVENGLSEKTLRKWLKMFKKRQLELYLPKFSIEGSYQLEKVL</p>

<p>Rabbit polyclonal SENP5 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CDH7 antibody, catalog no. 70R-6178</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LOC642141 antibody, catalog no. 70R-2169</p>

<p>COX6B2 antibody was raised in Rabbit using Human COX6B2 as the immunogen</p>

<p>Rabbit polyclonal RDH13 antibody</p>

<p>Mouse monoclonal alpha Actin antibody (muscle)</p>

<p>Rat monoclonal Ly6A/E antibody (FITC)</p>

<p>Rabbit polyclonal YARS2 antibody</p>

<p>Rabbit polyclonal SSBP1 antibody</p>

<p>Rabbit polyclonal TRIP13 antibody</p>

<p>The RAP1GDS1 antibody is a monoclonal antibody that specifically targets annexin A2. It is widely used in Life Sciences research for various applications, including immunohistochemistry, Western blotting, and flow cytometry. Annexin A2 plays a crucial role in cell signaling pathways, particularly those involving epidermal growth factor (EGF), low-density lipoprotein (LDL) receptor-related protein 1 (LRP1), basic protein (BP), collagen, endothelial growth factor (EGF), and transforming growth factor-beta (TGF-beta). This antibody allows researchers to study the expression and localization of annexin A2 in different cell types and tissues. With its high specificity and sensitivity, the RAP1GDS1 antibody is an invaluable tool for understanding the functions of annexin A2 in cellular processes and disease mechanisms.</p>

<p>AGXT2 antibody was raised using the N terminal of AGXT2 corresponding to a region with amino acids TSVTKLSLHTKPRMPPCDFMPERYQSLGYNRVLEIHKEHLSPVVTAYFQK</p>

<p>ZNF428 antibody was raised in rabbit using the middle region of ZNF428 as the immunogen</p>

<p>The CXCL12 antibody is a highly effective tool for researchers in the field of immunology. This antibody specifically targets and binds to CXCL12, a chemokine involved in immune responses. By binding to CXCL12, this antibody can modulate immune cell recruitment and activation.</p>

<p>FAM3B antibody was raised in Rabbit using Human FAM3B as the immunogen</p>

<p>Morphine-BSA is a fluorescent probe that is used in various applications in the field of Life Sciences. It consists of morphine, a potent analgesic, conjugated to Bovine Serum Albumin (BSA). This conjugate can be used as a tool to study the binding and internalization of morphine by cells expressing specific receptors. Additionally, Morphine-BSA can be employed in immunoassays for the detection and quantification of morphine or its metabolites. The high specificity of this monoclonal antibody ensures accurate and reliable results. Furthermore, Morphine-BSA can serve as a hapten conjugate for the development of new antibodies or as a control in experiments involving toxin subunits or growth factors. Its emission properties make it suitable for use with various imaging techniques such as fluorescence microscopy or flow cytometry. With its versatility and wide range of applications, Morphine-BSA is an invaluable tool for researchers in the field of Life Sciences.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PTK6 antibody, catalog no. 70R-5786</p>

<p>Rabbit polyclonal PRMT1 antibody (HRP)</p>

<p>HS3ST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELV</p>

<p>Purified Polyclonal SYT16 antibody</p>

<p>FAM107A antibody was raised in Rabbit using Human FAM107A as the immunogen</p>

<p>The Anti-CPV Antibody is a cytotoxic monoclonal antibody that specifically binds to cytidine. It is commonly used in Life Sciences research and drug development. This antibody can be utilized in various applications, including electrode-based assays and nanocomposite or colloidal systems. The Anti-CPV Antibody has shown promising results in inhibiting the growth factor signaling pathway and neutralizing autoantibodies, such as insulin antibodies. With its high specificity and potency, this antibody is a valuable tool for studying activated pathways and developing targeted therapies.</p>

<p>Rabbit polyclonal CYB5 antibody (biotin)</p>

<p>Rabbit Polyclonal Estrogen Receptor alpha antibody (Ser167)</p>

<p>Mouse monoclonal CD90.1 antibody (allophycocyanin)</p>

<p>The DLK1 antibody is a highly specific polyclonal antibody that binds to the antigen binding domain of the CB2 receptor. It is used in life sciences research to detect and study cell antigens and human enzymes. This antibody is produced using advanced techniques and has been validated for its high specificity and sensitivity. It can be used in various applications, including immunohistochemistry, western blotting, and ELISA assays. The DLK1 antibody is an essential tool for researchers working with biomolecules and studying specific antibodies. Its high affinity and specificity make it ideal for detecting and quantifying target proteins in biological samples. With its ability to bind to actin filaments, this antibody can provide valuable insights into cellular processes and signaling pathways.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC22A1 antibody, catalog no. 70R-1736</p>

<p>BNP antibody was raised in Mouse using synthetic peptide corresponding to aa (Gly-Leu-Gln-Glu-Gln-Arg-Asn-His-Leu-Gln-Gly-Lys-Leu-Cys) of human BNP, conjugated to KLH as the immunogen.</p>

<p>The Caveolin 1 antibody is a powerful tool in the field of life sciences. It is available in both polyclonal and monoclonal forms, providing researchers with options for their specific needs. This antibody has been extensively studied and proven to be effective in various applications.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FASTKD2 antibody, catalog no. 70R-3176</p>

<p>Rabbit polyclonal Tuberin antibody (Thr1462)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAIM antibody, catalog no. 70R-3010</p>

<p>Affinity purified Rabbit polyclonal TOM1 like protein 2 antibody</p>

<p>HPS3 antibody was raised in Rabbit using Human HPS3 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of STARD8 antibody, catalog no. 70R-9839</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NOMO1 antibody, catalog no. 70R-5291</p>

<p>Rabbit monoclonal VEGF antibody (biotin)</p>

<p>CD86 antibody was raised in rat using murine CD86 as the immunoge.</p>

<p>Rat monoclonal Toll-like receptor 4 antibody (PE)</p>

<p>UGT2B4 antibody was raised using the N terminal of UGT2B4 corresponding to a region with amino acids NIKTILDELVQRGHEVTVLASSASISFDPNSPSTLKFEVYPVSLTKTEFE</p>

<p>Purified recombinant ZFAND1 protein (His tag)</p>

<p>The ATF2 antibody is a highly specific and reliable tool for research in the field of Life Sciences. It is a polyclonal antibody that can be used to detect ATF2, a transcription factor involved in various cellular processes. This antibody has been extensively tested and validated for use in applications such as immunohistochemistry, Western blotting, and immunofluorescence.</p>

<p>Rabbit polyclonal p53 antibody (Ser315)</p>

<p>The AK3 antibody is a nuclear monoclonal antibody that targets growth factors in various biological processes. It has been shown to have a high affinity for echinococcus and sulphates. This antibody specifically binds to actin, a protein involved in cellular structure and movement. Additionally, it has been found to interact with tyrosine kinase-like receptors, which play a role in cell signaling pathways. The AK3 antibody is also effective in detecting steroid hormones and collagen, making it a valuable tool for research in the life sciences field. With its unique properties and buffered formulation, this antibody offers reliable and accurate results for your experiments and assays.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CCBP2 antibody, catalog no. 70R-7846</p>

<p>Rabbit polyclonal IKB alpha antibody (Tyr42)</p>

<p>Rat monoclonal B7DC antibody</p>

SLC29A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLLVCLRFLFVPLFMLCHVPQRSRLPILFPQDAYFITFMLLFAVSNGYLV

<p>KRT8 antibody was raised in Rabbit using Human KRT8 as the immunogen</p>

<p>Rabbit polyclonal CADM4 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Ppp3cb antibody, catalog no. 70R-9510</p>

<p>Purified recombinant Human GALT protein (His tag)</p>

<p>ARID2 antibody was raised in mouse using recombinant Human At Rich Interactive Domain 2 (Arid, Rfx-Like) (Arid2)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GJB6 antibody, catalog no. 70R-6097</p>

<p>Rabbit polyclonal TAF6L antibody</p>

<p>The WWP2 antibody is a polyclonal antibody that has neutralizing properties. It specifically targets the WWP2 protein, which is involved in various cellular processes such as the regulation of transferrin receptor levels and cyclase-activating signaling pathways. This antibody recognizes a conformational epitope on the WWP2 protein, allowing for accurate detection and analysis.</p>

<p>Recombinant human PDCL3 protein (His tag)</p>

<p>MRPS28 antibody was raised in Rabbit using Human MRPS28 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Itgb1 antibody, catalog no. 70R-9607</p>

<p>TUT1 antibody was raised in rabbit using the N terminal of TUT1 as the immunogen</p>

<p>Mouse monoclonal NGAL antibody (Biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DHX9 antibody, catalog no. 70R-4788</p>

<p>Purified Polyclonal Cytochrome P450 2B6 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CYP11B1 antibody, catalog no. 70R-9996</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth, preventing transcription and replication. This drug has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. Metabolized through various transformations, including hydrolysis and oxidation, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth. Trust this potent drug for effective treatment against tuberculosis.</p>

<p>Mouse monoclonal SSX5 antibody</p>

<p>RP11-269F19.9 antibody was raised using the N terminal Of Rp11-269F19.9 corresponding to a region with amino acids RGSMLGLAASFSRRNSLVGPGAGPGGQRPSLGPVPPLGSRVSFSGLPLAP</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EIF3E antibody, catalog no. 70R-3592</p>