Compuestos y reactivos bioquímicos

<p>Affinity purified Rabbit polyclonal Integrin alpha X antibody</p>

<p>Rabbit polyclonal Claudin 5 antibody (Tyr217)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DKC1 antibody, catalog no. 70R-5644</p>

<p>Keratin K8 protein is a vital component of the human hepatocytes and plays a crucial role in various biological processes. It is involved in maintaining the structural integrity of liver cells and regulating gene expression through messenger RNA (mRNA) stabilization. Keratin K8 protein is also known to interact with several cytochrome P450 (CYP) isoforms, which are responsible for metabolizing drugs and other xenobiotics in the liver.</p>

<p>Rabbit polyclonal PHACTR4 antibody</p>

<p>Rabbit polyclonal TNAP1 antibody</p>

<p>CST8 antibody was raised in rabbit using the N terminal of CST8 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal USP47 antibody</p>

<p>U2AF2 antibody was raised using the N terminal of U2AF2 corresponding to a region with amino acids EFERQLNENKQERDKENRHRKRSHSRSRSRDRKRRSRSRDRRNRDQRSAS</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EIF2C1 antibody, catalog no. 70R-3471</p>

<p>NCKAP1 antibody was raised in Rabbit using Human NCKAP1 as the immunogen</p>

<p>The GFAP protein is a highly specialized protein that plays a crucial role in various biological processes. It is involved in glutamate metabolism and can be found in human serum. The protein has been extensively studied using techniques such as polymerase chain reaction (PCR) and electrode assays.</p>

<p>FAM13C1 antibody was raised using the N terminal of FAM13C1 corresponding to a region with amino acids TEHVVSSQSECQVRAGTPAHESPQNNAFKCQETVRLQPRIDQRTAISPKD</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EDA antibody, catalog no. 70R-5943</p>

<p>CACNB4 antibody was raised using the C terminal of CACNB4 corresponding to a region with amino acids LEAYWRATHTTSSTPMTPLLGRNLGSTALSPYPTAISGLQSQRMRHSNHS</p>

<p>Affinity purified Rabbit polyclonal AKR7A2 antibody</p>

<p>KHDRBS2 antibody was raised in rabbit using the N terminal of KHDRBS2 as the immunogen</p>

<p>ML337 is a functional ligand that binds to the metabotropic glutamate receptor subtype 2 (mGlu2). It has been shown to be an allosteric modulator of mGlu2, where it acts as an agonist at low concentrations and as a negative allosteric modulator at high concentrations. ML337 has been shown to inhibit calcium-sensing receptor function in renal cells and may have potential for the treatment of chronic kidney diseases.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AKAP1 antibody, catalog no. 70R-5027</p>

<p>Rabbit polyclonal ADCY7 antibody</p>

<p>Region of MCP3 protein corresponding to amino acids QPVGINTSTT CCYRFINKKI PKQRLESYRR TTSSHCPREA VIFKTKLDKE ICADPTQKWV QDFMKHLDKK TQTPKL.</p>

<p>QRFPR antibody was raised in rabbit using the C terminal of QRFPR as the immunogen</p>

<p>The NFkB p65 antibody is a polyclonal antibody that targets the NFkB p65 protein. This protein plays a crucial role in various cellular processes, including the regulation of gene expression and immune response. The NFkB p65 antibody specifically binds to the NFkB p65 protein, allowing for its detection and analysis in various experimental settings.</p>

<p>The EFNA5 antibody is a highly specialized polyclonal antibody that targets EFNA5, a protein involved in various biological processes. This antibody has been extensively studied and proven to be effective in detecting and neutralizing EFNA5 in different research applications.</p>

<p>K 114 is a selective herbicide, which is a synthetic chemical intervention designed to target and manage unwanted plant species in agricultural settings. Derived from advanced chemical synthesis processes, it ensures high purity and efficacy in real-world applications. The mode of action involves the inhibition of key enzymatic pathways crucial for the survival and growth of broadleaf and grassy weeds, thereby effectively hindering their development without affecting the desired crops.</p>

<p>DIDO1 antibody was raised in Rabbit using Human DIDO1 as the immunogen</p>

<p>Purified Rabbit polyclonal OR10G6 antibody</p>

<p>Scara3 antibody was raised in rabbit using the middle region of Scara3 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PCDHAC1 antibody, catalog no. 70R-6120</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SNTG1 antibody, catalog no. 70R-3733</p>

<p>The Human IgG Fc fragment is a purified immunoglobulin that is commonly used in the field of life sciences. It is derived from human serum and has been activated through various processes such as fatty acid acetylation. This fragment plays a crucial role in immune responses by binding to specific receptors, including the growth factor-1 receptor, acidic growth factor, alpha-fetoprotein, telomerase, and antibodies. Additionally, it has been found to interact with chemokines and natriuretic factors. The Human IgG Fc fragment is widely utilized in research and diagnostic applications for its ability to accurately detect and quantify target molecules. Its high specificity and affinity make it an invaluable tool for studying immune responses and developing therapeutic interventions.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FRS3 antibody, catalog no. 70R-2077</p>

<p>The Chk1 antibody is a highly specialized antibody that specifically targets activated proteins in human serum. It binds to agonist proteins and neutralizes their effects, preventing them from causing any harm. The Chk1 antibody also has the ability to bind to serum albumin protein, enhancing its stability and prolonging its effectiveness.</p>

<p>EFS antibody was raised in Rabbit using Human EFS as the immunogen</p>

<p>The ACT1 antibody is a polyclonal antibody that specifically targets CD33, a cell surface protein. It has chemokine-neutralizing properties and can be used in various immunoassays and life science research. The ACT1 antibody is also available as a monoclonal antibody and can be used as an inhibitor of TNF-α, a pro-inflammatory cytokine. Additionally, this antibody has the ability to bind to nuclear proteins and neurotrophic factors such as TGF-β1 and natriuretic peptides. With its wide range of applications, the ACT1 antibody is an essential tool for researchers in the field of Life Sciences.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TNFSF13 antibody, catalog no. 70R-10214</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RNASEH2A antibody, catalog no. 70R-1626</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GPR18 antibody, catalog no. 70R-10503</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CTPS antibody, catalog no. 70R-1030</p>

<p>Mouse pan macrophages antibody was raised in rat using cultured macrophages as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNHIT3 antibody, catalog no. 70R-8914</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CYB5D1 antibody, catalog no. 70R-3280</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Pigw antibody, catalog no. 70R-8806</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, thereby inhibiting transcription and replication. Its efficacy has been proven through extensive research using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique.</p>

<p>Rabbit polyclonal H3F3A antibody (HRP)</p>

<p>HPSE antibody was raised in rabbit using the N terminal of HPSE as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DDX19B antibody, catalog no. 70R-1388</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AK5 antibody, catalog no. 70R-3556</p>

<p>Recombinant human VAT1 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ANKRD54 antibody, catalog no. 70R-4555</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of YPEL5 antibody, catalog no. 70R-9444</p>

<p>The HSPA9 antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets HSPA9, also known as heat shock 70kDa protein 9. This protein plays a crucial role in various cellular processes, including cell survival and apoptosis.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C11orf67 antibody, catalog no. 70R-4245</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OPN5 antibody, catalog no. 70R-9904</p>

<p>1-184 amino acids: MAEPQPPSGG LTDEAALSCC SDADPSTKDF LLQQTMLRVK DPKKSLDFYT RVLGMTLIQK CDFPIMKFSL YFLAYEDKND IPKEKDEKIA WALSRKATLE LTHNWGTEDD ETQSYHNGNS DPRGFGHIGI AVPDVYSACK RFEELGVKFV KKPDDGKMKG LAFIQDPDGY WIEILNPNKM ATLM</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FCGRT antibody, catalog no. 70R-5991</p>

<p>CCIN antibody was raised in Rabbit using Human CCIN as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GHRHR antibody, catalog no. 70R-7058</p>

<p>Upp2 antibody was raised in rabbit using the C terminal of Upp2 as the immunogen</p>

<p>The CDC2 antibody is a highly specific monoclonal antibody that targets the CDC2 protein. This protein plays a crucial role in cell division and is involved in regulating the cell cycle. The CDC2 antibody has been extensively studied and shown to have neutralizing effects on the activity of CDC2, making it an excellent tool for researchers studying cell division and related processes.</p>

<p>The SNAP23 antibody is a monoclonal antibody that specifically targets the protein SNAP23. This protein plays a crucial role in various cellular processes, including vesicle fusion and membrane trafficking. The SNAP23 antibody can be used in Life Sciences research to study the function of SNAP23 and its interactions with other proteins.</p>

<p>The Elk1 antibody is a highly effective medicament that targets fatty acids and inhibits their activity. It belongs to the class of anti-CD20 antibodies, which are widely used in Life Sciences research. This monoclonal antibody has been extensively studied and characterized using various chromatographic techniques. It is known for its neutralizing properties and can effectively block the action of specific fatty acids.</p>

<p>CDC45L antibody was raised in Rabbit using Human CDC45L as the immunogen</p>

<p>Affinity purified Rabbit polyclonal Dipeptidyl peptidase 3 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DKFZp686E2433 antibody, catalog no. 70R-9118</p>

<p>MKRN1 antibody was raised using the N terminal of MKRN1 corresponding to a region with amino acids GDRCRYEHSKPLKQEEATATELTTKSSLAASSSLSSIVGPLVEMNTGEAE</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACTR3B antibody, catalog no. 70R-3517</p>

<p>Rabbit polyclonal Fibrillin 1 antibody</p>

<p>EXOD1 antibody was raised using the N terminal Of Exod1 corresponding to a region with amino acids GQIDSEFQAYVQPQEHPILSEFCMELTGIKQAQVDEGVPLKICLSQFCKW</p>

<p>DRD1 antibody was raised in Rabbit using Human DRD1 as the immunogen</p>

<p>FRS2 antibody was raised in Rabbit using Human FRS2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACP6 antibody, catalog no. 70R-2674</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth. Extensive research has shown its high efficacy through various techniques like patch-clamp on human erythrocytes. Metabolically, it undergoes hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it selectively binds to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Rabbit anti-rat IgG (HRP) was raised in rabbit using rat IgG F(c) fragment as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PPP1R15B antibody, catalog no. 70R-10145</p>

<p>TRABD antibody was raised using the middle region of TRABD corresponding to a region with amino acids LCFLSDPISKDDVERCKQKDLLEQMMAEMIGEFPDLHRTIVSERDVYLTY</p>

<p>Rabbit IgG Fc is a purified immunoglobulin that is derived from rabbit serum. It is commonly used in life sciences research as a specific antibody for various applications. Rabbit IgG Fc can be used in chemiluminescent immunoassays to detect the presence of specific antigens, such as collagen or insulin. This purified immunoglobulin has been shown to have high affinity and specificity for its target, making it an ideal tool for immunological studies. Additionally, Rabbit IgG Fc can be labeled with radioactive isotopes, such as 125i, for use in radioimmunoassays or other detection methods.</p>

<p>The SPIN1 antibody is a highly specialized product that falls under the category of antibodies. It is available in both polyclonal and monoclonal forms. This antibody has been extensively studied for its antinociceptive properties, making it a valuable tool in pain research.</p>

<p>PFI-4 is a small molecule that has been shown to inhibit cancer cell growth and proliferation. It is a hydroxyl group analog that binds to the bromodomain of proteins in the cellular nucleus and blocks the interaction between acetylated histones and transcription factors. PFI-4 also inhibits virus replication, specifically influenza virus, by binding to the stem cell-like antigen. This drug is an optical imaging agent that can be used for optical imaging of cells with stem cell-like phenotypes. PFI-4 also inhibits tumor growth by disrupting the disulfide bond in water molecules.</p>

<p>Affinity purified Rabbit polyclonal GADD45 gamma antibody</p>

<p>Endoglin antibody was raised using a synthetic peptide corresponding to a region with amino acids ILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQ</p>

<p>The FOS antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and is specifically designed for targeting beta amyloid. This antibody can be used in various research applications, including the detection and analysis of alpha-fetoprotein, chemokines, phosphatases, and growth factors. The FOS antibody is known for its high specificity and sensitivity in recognizing and binding to its target molecules. It can be utilized in techniques such as immunohistochemistry, western blotting, ELISA, and flow cytometry. With its trifunctional properties, this antibody has the ability to inhibit protein kinases, act as an electrode for electrochemical assays, and serve as a valuable tool in studying thrombocytopenia. The FOS antibody is produced using state-of-the-art technology and undergoes rigorous quality control measures to ensure its effectiveness and reliability.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RP11-78J21.1 antibody, catalog no. 70R-4772</p>

<p>Region of IGF BP7 protein corresponding to amino acids MSSSDTCGPC EPASCPPLPP LGCLLGETRD ACGCCPMCAR GEGEPCGGGG AGRGYCAPGM ECVKSRKRRK GKAGAAAGGP GVSGVCVCKS RYPVCGSDGT TYPSGCQLRA ASQRAESRGE KAITQVSKGT CEQGPSIVTP PKDIWNVTGA QVYLSCEVIG IPTPVLIWNK VKRGHYGVQR TELLPGDRDN LAIQTRGGPE KHEVTGWVLV SPLSKEDAGE YECHASNSQG QASASAKITV VDALHEIPVK KGEGAEL.</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SCN3B antibody, catalog no. 70R-5225</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAM82B antibody, catalog no. 70R-4099</p>

<p>Affinity purified Rabbit polyclonal LRP130 antibody</p>

<p>Cytokeratin 10 antibody is a monoclonal antibody that specifically targets and binds to cytokeratin 10, a protein found in epithelial cells. This antibody is commonly used in life sciences research to study the expression and localization of cytokeratin 10 in various tissues and cell types. Cytokeratin 10 plays a crucial role in maintaining the structural integrity of epithelial cells and is involved in cell adhesion, migration, and differentiation processes. By targeting cytokeratin 10, this antibody enables researchers to gain valuable insights into the cellular mechanisms underlying tissue development, wound healing, and diseases such as cancer. With its high specificity and sensitivity, the cytokeratin 10 antibody is an essential tool for scientists investigating the complex functions of epithelial cells in both normal and pathological conditions.</p>

<p>The VEGFD antibody is a powerful tool in the field of Life Sciences. It acts as an inhibitor against TGF-β1 and chemokine, making it an essential component in various research studies. This monoclonal antibody has shown inhibitory properties against protein kinase, insulin, and natriuretic factors. Its unique design allows for precise targeting and binding to specific molecules, ensuring accurate results in immunoassays. With its ability to neutralize interferon activity, the VEGFD antibody opens up new possibilities for studying neurotrophic factors and their role in different biological processes. Researchers can rely on this high-quality antibody to enhance their experiments and gain valuable insights into cellular mechanisms.</p>

<p>Purified Polyclonal SYT antibody</p>

<p>Rabbit polyclonal Lambda light chain antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC25A16 antibody, catalog no. 70R-6499</p>

<p>Region of IL16 protein corresponding to amino acids MPDLNSSTDS AASASAASDV SVESTAEATV CTVTLEKMSA GLGFSLEGGK GSLHGDKPLT INRIFKGAAS EQSETVQPGD EILQLGGTAM QGLTRFEAWN IIKALPDGPV TIVIRRKSLQ SKETTAAGDS.</p>

<p>Complement C3 antibody was raised in goat using human C3 complement as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DDX47 antibody, catalog no. 70R-4750</p>

<p>TPD52L3 antibody was raised using the middle region of TPD52L3 corresponding to a region with amino acids GLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATLRS</p>

<p>S100A8 antibody was raised in rabbit using the middle region of S100A8 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LSM14A antibody, catalog no. 70R-4243</p>

<p>Rabbit polyclonal HADHB antibody (biotin)</p>

<p>Goat anti-rat IgM (biotin) was raised in goat using rat IgM mu chain as the immunogen.</p>

<p>SCAND2 antibody was raised in rabbit using the middle region of SCAND2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF205 antibody, catalog no. 20R-1197</p>

<p>MARCKS antibody was raised in rabbit using the C terminal of MARCKS as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OCIAD2 antibody, catalog no. 70R-3678</p>

<p>Rabbit polyclonal Major capsid protein L1 antibody</p>

<p>Rabbit polyclonal RPS18 antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GIMAP6 antibody, catalog no. 70R-9374</p>

<p>SPRR3 antibody was raised using the middle region of SPRR3 corresponding to a region with amino acids DQGFIKFPEPGAIKVPEQGYTKVPVPGYTKLPEPCPSTVTPGPAQQKTKQ</p>

<p>Rabbit polyclonal RPS25 antibody (FITC)</p>

<p>The MARCKS antibody is a highly specialized antibody that plays a crucial role in various biological processes. It is known to be involved in necrosis factor-related apoptosis-inducing pathways, as well as growth factor signaling. This antibody has been shown to interact with influenza hemagglutinin and regulate microvessel density.</p>

<p>MAGEA4 antibody was raised using the C terminal of MAGEA4 corresponding to a region with amino acids ENYLEYRQVPGSNPARYEFLWGPRALAETSYVKVLEHVVRVNARVRIAYP</p>

<p>Rabbit polyclonal TAX1BP3 antibody (HRP)</p>

<p>Cingulin antibody was raised in Guinea Pig using Full length GST-fusion protein of human cingulin as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ATG9A antibody, catalog no. 70R-6415</p>

<p>SND1/P100 antibody was raised in Mouse using a purified recombinant fragment of SND1 (aa361-485) expressed in E. coli as the immunogen.</p>

<p>Purified Polyclonal MRPL14 antibody</p>

<p>The Cox2 antibody is a growth factor that targets a specific cell antigen known as endothelial growth. It belongs to the category of polyclonal antibodies and is widely used in the field of Life Sciences. This antibody has been shown to have interactions with various proteins, including fibrinogen, lipoprotein lipase, and amyloid plaque. Additionally, it can inhibit the activity of lipase and phosphatase enzymes. The Cox2 antibody is available in both polyclonal and monoclonal forms, making it suitable for different research purposes. It is often used to detect autoantibodies or as a tool for studying triglyceride lipase activity. With its versatile applications, this antibody is an essential tool for researchers in various fields.</p>

<p>Please enquire for more information about GSK 591 dihydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. Its potency has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their growth in culture.</p>

<p>Fresh tissue lysate prepared from rabbit liver</p>

<p>ATL2 antibody was raised in Rabbit using Human ATL2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EWSR1 antibody, catalog no. 70R-5013</p>

<p>Purified Horse IgG (Fc) FITC conjugate</p>

<p>HNRPL antibody was raised using the N terminal of HNRPL corresponding to a region with amino acids RRRSGAMVKMAAAGGGGGGGRYYGGGSEGGRAPKRLKTDNAGDQHGGGGG</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ALKBH2 antibody, catalog no. 70R-4415</p>

<p>Purified recombinant Human PPCS protein</p>

<p>DNAL4 antibody was raised in Rabbit using Human DNAL4 as the immunogen</p>

<p>Rabbit polyclonal PBX3 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PIGF antibody, catalog no. 70R-7111</p>

<p>BMS-1001 hydrochloride is a peptide that is an activator of ion channels. It has been shown to inhibit the activation of potassium channels and calcium channels in rat brain slices. BMS-1001 hydrochloride also binds to the receptor site of human calcitonin gene-related peptide (CGRP) and blocks its binding to CGRP receptor sites on mast cells. This prevents the release of histamine, which is responsible for allergic reactions such as hay fever, asthma, and chronic urticaria.<br>BMS-1001 hydrochloride has been shown to be a potent inhibitor of protein interactions with ligands and receptors. It inhibits the interaction between human erythropoietin (EPO) and its receptor by competing with endogenous EPO for binding sites on the surface of erythrocytes.</p>

<p>CCL13 antibody was raised in rabbit using the middle region of CCL13 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NDP antibody, catalog no. 70R-6210</p>

<p>basic hair keratin K86 antibody was raised in Guinea Pig using synthetic peptide of human basic hair (trichocytic) keratin K86 coupled to KLH as the immunogen.</p>

<p>Rabbit polyclonal PIP5KL1 antibody</p>

<p>Region of Beta NGF protein corresponding to amino acids MSSTHPVFHM GEFSVCDSVS VWVGDKTTAT DIKGKEVTVL AEVNINNSVF RQYFFETKCR ASNPVESGCR GIDSKHWNSY CTTTHTFVKA LTTDEKQAAW RFIRIDTACV CVLSRKATRR G.</p>

<p>Rabbit polyclonal PCDHB15 antibody</p>

<p>CKM antibody was raised in Rabbit using Human CKM as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of WNT2B antibody, catalog no. 70R-2239</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SMC2 antibody, catalog no. 70R-2053</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RXRB antibody, catalog no. 70R-1919</p>

<p>Affinity purified Rabbit polyclonal Proteasome 20S alpha 3 antibody</p>

<p>Inhibitor of pan-AKT</p>

<p>ADK antibody was raised in mouse using recombinant human ADK (22-362aa) purified from E. coli</p>

<p>CX40.1 antibody was raised using the C terminal of CX40.1 corresponding to a region with amino acids QPRGRPHREAAQDPRGSGSEEQPSAAPSRLAAPPSCSSLQPPDPPASSSG</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TNNT1 antibody, catalog no. 70R-2585</p>

<p>Rabbit polyclonal ANP32B antibody</p>

<p>1-491 amino acids: MAVTQTAQAC DLVIFGAKGD LARRKLLPSL YQLEKAGQLN PDTRIIGVGR ADWDKAAYTK VVREALETFM KETIDEGLWD TLSARLDFCN LDVNDTAAFS RLGAMLDQKN RITINYFAMP PSTFGAICKG LGEAKLNAKP ARVVMEKPLG TSLATSQEIN DQVGEYFEEC QVYRIDHYLG KETVLNLLAL RFANSLFVNN WDNRTIDHVE ITVAEEVGIE GRWGYFDKAG QMRDMIQNHL LQILCMIAMS PPSDLSADSI RDEKVKVLKS LRRIDRSNVR EKTVRGQYTA GFAQGKKVPG YLEEEGANKS SNTETFVAIR VDIDNWRWAG VPFYLRTGKR LPTKCSEVVV YFKTPELNLF KESWQDLPQN KLTIRLQPDE GVDIQVLNKV PGLDHKHNLQ ITKLDLSYSE TFNQTHLADA YERLLLETMR GIQALFVRRD EVEEAWKWVD SITEAWAMDN DAPKPYQAGT WGPVASVAMI TRDGRSWNEF E</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C10orf33 antibody, catalog no. 70R-3261</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PEX5 antibody, catalog no. 70R-2342</p>

The SOD antibody is a powerful tool in the field of Life Sciences. It is a cytotoxic and multidrug antibody that targets lipoprotein lipase, albumin, retinoid, and other important molecules. This polyclonal antibody has been extensively studied and shown to have high affinity for its target molecules. It has been used in various research applications, including the detection of interleukin-6, collagen, and other proteins in human serum. Additionally, this monoclonal antibody has been compared to adalimumab and shown to be highly effective in inhibiting the activity of TNF-α. Its versatility and reliability make it an essential tool for researchers in the field of Life Sciences.

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FBP1 antibody, catalog no. 70R-1222</p>

<p>NCOR1 antibody was raised in Mouse using a purified recombinant fragment of NCOR1(aa1-192) expressed in E. coli as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CRP antibody, catalog no. 70R-4527</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PCK1 antibody, catalog no. 70R-2484</p>

<p>Purified Rabbit polyclonal MYB27 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PIWIL2 antibody, catalog no. 70R-2277</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Prr16 antibody, catalog no. 70R-9461</p>

<p>Mouse monoclonal Hepatitis C Virus antibody (core)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FBLN1 antibody, catalog no. 70R-5356</p>

<p>Streptavidin Poly-HRP20 Conjugate (diluted to 50ug/ml in stabilizer 85R-1028).</p>

A synthetic peptide for use as a blocking control in assays to test for specificity of EWSR1 antibody, catalog no. 70R-4833

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Sdc3 antibody, catalog no. 70R-8670</p>

<p>Rabbit polyclonal NFKP p65 antibody</p>

<p>ZNF527 antibody was raised in rabbit using the C terminal of ZNF527 as the immunogen</p>

<p>Rabbit polyclonal ADCK2 antibody</p>

<p>Rabbit Polyclonal PLCG2 antibody (Tyr1217)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRAFD1 antibody, catalog no. 70R-7948</p>

<p>The uPA antibody is a highly specialized protein kinase that plays a crucial role in various biological processes. This monoclonal antibody specifically targets the urokinase plasminogen activator (uPA), which is an important enzyme involved in tissue remodeling and cell migration. By binding to the uPA antigen, this antibody effectively inhibits its activity, preventing the degradation of extracellular matrix components and suppressing tumor invasion and metastasis.</p>

<p>Goat anti-rabbit IgG (H+L) (FITC) was raised in goat using rabbit IgG, whole molecule as the immunogen.</p>

<p>EIF3F antibody was raised in rabbit using the N terminal of EIF3F as the immunogen</p>

<p>Recombinant human PSMB3 protein (His tag)</p>

<p>Rabbit polyclonal Ephrin A4 antibody</p>

<p>Purified recombinant Human RANBP1 Protein (His tag)</p>

<p>AMZ2 antibody was raised in Rabbit using Human AMZ2 as the immunogen</p>