Compuestos y reactivos bioquímicos

<p>DNAJB2 antibody was raised in Rabbit using Human DNAJB2 as the immunogen</p>

<p>Plasminogen antibody was raised in goat using human plasminogen purified from plasma as the immunogen.</p>

<p>The ABL1 antibody is a powerful tool used in the field of Life Sciences for various applications. It is an antibody specifically designed to target and bind to the ABL1 protein, which plays a crucial role in cell signaling and regulation. This antibody can be used for research purposes, such as studying the function of ABL1 in different cellular processes or investigating its involvement in diseases like cancer.</p>

<p>CD71 antibody (Azide free) was raised in rat using CD71/transferrin receptor as the immunogen.</p>

<p>TNFRSF14 antibody was raised in rabbit using the middle region of TNFRSF14 as the immunogen</p>

<p>PEA15 antibody was raised in rabbit using the C terminal of PEA15 as the immunogen</p>

<p>OVA antibody was raised in Mouse using Ovalbumin as the immunogen.</p>

<p>Affinity purified Rabbit polyclonal SRPX antibody</p>

<p>Cyb5r2 antibody was raised in rabbit using the C terminal of Cyb5r2 as the immunogen</p>

<p>TRIM48 antibody was raised in rabbit using the C terminal of TRIM48 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DSCAM antibody, catalog no. 70R-6114</p>

<p>Rabbit polyclonal CCRK antibody</p>

<p>ACOT9 antibody was raised in rabbit using the C terminal of ACOT9 as the immunogen</p>

<p>MED1 antibody is a protein that belongs to the category of polyclonal antibodies. It is commonly used in the field of life sciences for various applications. MED1 antibody specifically targets erythropoietin, adalimumab, and other autoantibodies. It can also be used to detect and measure levels of androgen, TGF-beta, alpha-fetoprotein, interferon, and other growth factors. This specific antibody provides researchers with a valuable tool for studying the role of these proteins in various biological processes and diseases. With its high specificity and sensitivity, MED1 antibody ensures accurate and reliable results in experiments and diagnostic assays.</p>

<p>LOC390738 antibody was raised in rabbit using the middle region of LOC390738 as the immunogen</p>

<p>The GluR4 antibody is a highly specialized antibody used in Life Sciences research. It is commonly used in studies involving glutamate receptors and their role in various biological processes. This antibody specifically targets the GluR4 subunit, which is known to be involved in neuronal excitability and synaptic plasticity.</p>

<p>Purified Dog IgG (Fc)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CDH3 antibody, catalog no. 70R-1708</p>

<p>Rabbit polyclonal VOPP1 antibody</p>

<p>Rabbit polyclonal AFG3L2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NEGR1 antibody, catalog no. 70R-9341</p>

<p>The AQP1 antibody is a monoclonal antibody that targets the aquaporin-1 (AQP1) protein. Aquaporins are a family of water channel proteins that play a crucial role in regulating water transport across cell membranes. AQP1 is specifically expressed in endothelial cells, where it facilitates the movement of water and small solutes across blood vessels.</p>

<p>Purified Polyclonal LZK antibody</p>

<p>CHRNA9 antibody was raised in rabbit using the N terminal of CHRNA9 as the immunogen</p>

<p>Purified recombinant Human UBL4A protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ATP6V1A antibody, catalog no. 70R-3013</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ARID5A antibody, catalog no. 70R-9027</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NCL antibody, catalog no. 70R-4742</p>

<p>AGR3 antibody was raised in Rabbit using Human AGR3 as the immunogen</p>

<p>Desmoglein 4 antibody is an antiviral agent that is commonly used in Life Sciences research. It is a high-flux antibody that can be used for staining and detection purposes. This antibody specifically targets desmoglein 4, which is an extracellular antigen involved in cell adhesion. Desmoglein 4 antibody can be used as a serum marker to detect the presence of this antigen in various biological samples. It is available in both polyclonal and monoclonal forms, providing options for different experimental needs. This antibody has potential applications in chemotherapy, as well as in the study of interleukins and autoantibodies. With its versatility and specificity, desmoglein 4 antibody offers researchers a valuable tool for their investigations in the field of Life Sciences.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LCOR antibody, catalog no. 70R-9910</p>

<p>CLASP2 antibody was raised in Rabbit using Human CLASP2 as the immunogen</p>

<p>LRRC20 antibody was raised using the middle region of LRRC20 corresponding to a region with amino acids TTFSQLRELHLEGNFLHRLPSEVSALQHLKAIDLSRNQFQDFPEQLTALP</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TST antibody, catalog no. 70R-2439</p>

<p>AHSA1 antibody was raised in Rabbit using Human AHSA1 as the immunogen</p>

<p>FTSJD1 antibody was raised using the middle region of FTSJD1 corresponding to a region with amino acids LMYLLNCCFDQVHVFKPATSKAGNSEVYVVCLHYKGREAIHPLLSKMTLN</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PP2447 antibody, catalog no. 70R-1269</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LOC652618 antibody, catalog no. 70R-2982</p>

<p>Rabbit polyclonal APIP antibody</p>

<p>Rabbit Polyclonal VEGFR2 antibody (Tyr1214)</p>

<p>The PLS3 antibody is a monoclonal antibody that targets the growth factor phospholipid scramblase (PLS3). It is used in Life Sciences research to study the role of PLS3 in various cellular processes. The antibody is produced using cellulose as a support material and has been shown to specifically bind to PLS3. It can be used in experiments involving human serum, as it does not react with serum albumin or other common serum proteins. The PLS3 antibody is also available as a polyclonal antibody for researchers who require larger quantities or need to target multiple epitopes.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HKR1 antibody, catalog no. 20R-1118</p>

<p>The NPTX1 antibody is a highly specific polyclonal antibody that targets the NPTX1 protein. NPTX1 is an oncogene homolog and plays a crucial role in various biological processes, including cholinergic signaling and β-catenin activation. This antibody has been extensively validated in life sciences research and has shown high specificity and sensitivity in detecting NPTX1 expression.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UBE2E3 antibody, catalog no. 70R-2766</p>

<p>Rabbit polyclonal Mnk1 antibody</p>

<p>MPS1 antibody was raised in Mouse using a purified recombinant fragment of MPS1 expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal OPA3 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its efficacy has been demonstrated through patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of E130307M08RIK antibody, catalog no. 20R-1150</p>

<p>Purified recombinant Human CBX3 Protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LOC391764 antibody, catalog no. 70R-9050</p>

<p>The ASK1 antibody is a powerful tool in the field of life sciences. It is a polyclonal antibody that specifically targets and neutralizes the activity of apoptosis signal-regulating kinase 1 (ASK1). ASK1 plays a crucial role in various cellular processes, including cell growth, differentiation, and apoptosis. By blocking the activity of ASK1, this antibody can provide valuable insights into the molecular mechanisms underlying these processes.</p>

<p>The CRY1 antibody is a powerful antiviral agent that has been pegylated for enhanced stability and efficacy. It works by neutralizing the activity of specific viruses, preventing them from infecting host cells. Additionally, the CRY1 antibody stimulates the production of colony-stimulating factors and chemokines, which help to mobilize immune cells and enhance the body's natural defense mechanisms against viral infections.</p>

<p>The IL31RA antibody is a monoclonal antibody that specifically targets the IL-31 receptor alpha (IL31RA). This antibody is designed to block the binding of IL-31, a cytokine involved in inflammation and itching, to its receptor. By inhibiting this interaction, the IL31RA antibody can potentially alleviate symptoms associated with inflammatory skin conditions such as atopic dermatitis.</p>

<p>SRPR antibody was raised using a synthetic peptide corresponding to a region with amino acids EEFIQKHGRGMEKSNKSTKSDAPKEKGKKAPRVWELGGCANKEVLDYSTP</p>

<p>Rabbit polyclonal CTDNEP1 antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C1QTNF4 antibody, catalog no. 70R-5423</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HLA-DQA2 antibody, catalog no. 70R-4488</p>

<p>B3galt2 antibody was raised in rabbit using the C terminal of B3galt2 as the immunogen</p>

<p>MMP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEF</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MTMR14 antibody, catalog no. 70R-3995</p>

<p>Mettl4 antibody was raised in rabbit using the C terminal of Mettl4 as the immunogen</p>

<p>Purified Polyclonal PDLIM1 antibody</p>

<p>The DNASE1L3 antibody is a monoclonal antibody that specifically targets DNASE1L3, an enzyme involved in the degradation of DNA. This antibody has high affinity and specificity for DNASE1L3 and can be used as a diagnostic reagent in various research and clinical settings.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC35F5 antibody, catalog no. 70R-1798</p>

<p>AKR1C2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPV</p>

<p>Affinity purified Rabbit polyclonal ITGA1 antibody</p>

<p>NAGS antibody was raised in Rabbit using Human NAGS as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LOC100364462 antibody, catalog no. 70R-9134</p>

<p>CCNL1 antibody was raised in Rabbit using Human CCNL1 as the immunogen</p>

<p>The p90RSK antibody is a highly specialized monoclonal antibody that targets the p90 ribosomal S6 kinase (p90RSK). This antibody is widely used in life sciences research to study various cellular processes and signaling pathways. It specifically binds to p90RSK, a protein kinase that plays a crucial role in cell growth, proliferation, and survival.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UBASH3A antibody, catalog no. 70R-2635</p>

<p>PKM2 antibody was raised in rabbit using the middle region of PKM2 as the immunogen</p>

<p>Purified recombinant Human SRI protein</p>

<p>The SCAMP3 antibody is a polyclonal antibody that specifically targets the alpha-fetoprotein hormone peptide. It is widely used in life sciences research and has been proven to be effective in serotonergic studies. This antibody can be immobilized on an electrode for various applications, including antigen detection and fatty acid analysis. Additionally, it can be activated for use in assays targeting specific antibodies such as anti-HBs or c-myc. The SCAMP3 antibody also shows potential as an inhibitor in certain experimental settings. With its versatility and specificity, this antibody is a valuable tool for researchers in various fields.</p>

<p>Region of BD1 protein corresponding to amino acids GNFLTGLGHR SDHYNCVSSG GQCLYSACPI FTKIQGTCYR GKAKCCK.</p>

<p>Rpia antibody was raised in rabbit using the middle region of Rpia as the immunogen</p>

<p>MGC51025 antibody was raised using the middle region of Mgc51025 corresponding to a region with amino acids RGRAWSLLLDIDRIKSQNPGKYKVMKEKGKRSSRIIHCIQLDVSHTLQKH</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MATN2 antibody, catalog no. 70R-2250</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZRSR2 antibody, catalog no. 70R-1377</p>

<p>The Cytokeratin 18 Antibody is a diagnostic reagent used in Life Sciences for the detection of specific antibodies in human serum. It has high affinity and specificity for cytokeratin 18, a protein found in epithelial cells. This antibody can be used to study the expression and distribution of cytokeratin 18 in various tissues and cell types. Additionally, it can be used as a tool to investigate the role of cytokeratin 18 in cellular processes such as cell migration, adhesion, and proliferation. The Cytokeratin 18 Antibody is conjugated with sorafenib, which enhances its binding affinity and stability. This monoclonal antibody is immobilized on crystalline cellulose, allowing for easy handling and storage. With its high sensitivity and accuracy, the Cytokeratin 18 Antibody is an essential tool for researchers studying epithelial biology and related diseases.</p>

<p>Purified recombinant Human SRP14 protein</p>

<p>The PLAT antibody is a monoclonal antibody that specifically targets fibrinogen. It has been extensively studied in the field of Life Sciences and is widely used in research and diagnostic applications. This antibody has shown excellent binding affinity and specificity for fibrinogen, making it an ideal tool for various experimental techniques.</p>

<p>Affinity purified Rabbit polyclonal DUSP26 antibody</p>

<p>Rabbit polyclonal AMPK alpha 1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SIGLEC7 antibody, catalog no. 70R-6151</p>

<p>Rabbit anti-bovine IgG (Rhodamine) was raised in rabbit using bovine IgG F(c) fragment as the immunogen.</p>

<p>Vitronectin antibody was raised in sheep using human Vitronectin purified from plasma as the immunogen.</p>

<p>RIT1 antibody was raised in rabbit using the middle region of RIT1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CLCN6 antibody, catalog no. 70R-1521</p>

<p>INPP5K antibody was raised in rabbit using the C terminal of INPP5K as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PDPK1 antibody, catalog no. 70R-7831</p>

<p>TRAPPC5 antibody was raised in rabbit using the N terminal of TRAPPC5 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TMTC4 antibody, catalog no. 70R-6839</p>

<p>The Paxillin antibody is an anti-connexin agent that specifically targets and neutralizes the activity of connexin proteins. Connexins are glycoproteins that form gap junctions between cells, allowing for direct cell-to-cell communication. This monoclonal antibody recognizes and binds to specific glycan structures on connexins, inhibiting their function.</p>

<p>The SSTR2 antibody is a highly specialized monoclonal antibody that targets the somatostatin receptor 2 (SSTR2). This antibody has been extensively studied and characterized for its ability to specifically bind to SSTR2, making it an invaluable tool in various research applications.</p>

<p>GTF2B antibody was raised in rabbit using the C terminal of GTF2B as the immunogen</p>

<p>CD25 antibody is a monoclonal antibody that specifically targets CD25, a glycoprotein expressed on the surface of activated T cells. It is commonly used in research and clinical settings to study and treat conditions related to T cell activation, such as autoimmune diseases and certain types of cancer.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Sbk1 antibody, catalog no. 70R-8791</p>

<p>The Keratin 15 antibody is a glycopeptide that targets the human serum androgen. It is an essential tool for researchers in the field of Life Sciences, as it plays a crucial role in various cellular processes. This antibody specifically recognizes Keratin 15, which is a protein involved in the maintenance and integrity of epithelial tissues.</p>

<p>PPIF antibody was raised using a synthetic peptide corresponding to a region with amino acids GSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLS</p>

<p>Region of Osteoprotegerin protein corresponding to amino acids METFPPKYLH YDEETSHQLL CDKCPPGTYL KQHCTAKWKT VCAPCPDHYY TDSWHTSDEC LYCSPVCKEL QYVKQECNRT HNRVCECKEG RYLEIEFCLK HRSCPPGFGV VQAGTPERNT VCKRCPDGFF SNETSSKAPC RKHTNCSVFG LLLTQKGNAT HDNICSGNSE STQK.</p>

<p>Rabbit polyclonal Canine Serum Albumin antibody (biotin)</p>

<p>Myelin protein P0 is a growth factor that belongs to the group of Proteins and Antigens. It is similar in structure to ovalbumin and contains tyrosine, which plays a crucial role in its biological activity. Myelin protein P0 has been shown to have various functions, including promoting the growth of endothelial cells and stimulating epidermal growth factor receptor signaling. This protein can be produced using recombinant technology and is commonly used in research studies within the field of Life Sciences. Monoclonal antibodies specific to myelin protein P0 are available for use in experiments and assays. These antibodies bind specifically to myelin protein P0, allowing for its detection and analysis. Myelin protein P0 is often used as a target molecule in studies related to nerve regeneration, demyelinating diseases, and neurodegenerative disorders. Its unique properties make it an essential component in many scientific investigations within the field of Life Sciences.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CANX antibody, catalog no. 70R-9880</p>

<p>CD62L antibody was raised in rat using C3H/eb cloned murine B lymphoma 38C-13 as the immunogen.</p>

<p>ARHGAP19 antibody was raised in rabbit using the C terminal of ARHGAP19 as the immunogen</p>

<p>Purified Polyclonal RPL10L antibody</p>

<p>Affinity purified Rabbit polyclonal Phospho-ORF50 antibody</p>

<p>Goat anti-rat IgG (H+L) was raised in goat using rat IgG whole molecule as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CYB561 antibody, catalog no. 70R-7064</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OCLN antibody, catalog no. 70R-6335</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FLII antibody, catalog no. 70R-2267</p>

<p>Rabbit anti-rat IgG was raised in rabbit using rat IgG F(ab')2 fragment as the immunogen.</p>

<p>The Bcr antibody is a powerful tool in the field of Life Sciences. This polyclonal antibody specifically targets the epidermal growth factor and histidine, which are crucial for various cellular processes. It has been shown to be highly effective in activating chemokine signaling pathways and promoting cell growth. Additionally, the Bcr antibody can be used as a monoclonal antibody to detect collagen levels in tissues and cells. Its phosphatase activity makes it an ideal candidate for cytotoxic applications, making it a versatile tool in research and development. Whether you're studying growth factors or looking for a potential medicament, the Bcr antibody is an essential asset to have in your laboratory.</p>

<p>Affinity purified Rabbit polyclonal NR0B1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NUDT6 antibody, catalog no. 70R-10412</p>

<p>The HSP70 antibody is a polyclonal antibody that specifically binds to heat shock protein 70 (HSP70). Heat shock proteins are a group of proteins that are produced in response to stress, such as high temperatures or exposure to toxins. HSP70 is involved in various cellular processes, including protein folding, transport, and degradation.</p>

<p>STK39 antibody was raised using a synthetic peptide corresponding to a region with amino acids  KYIVNRGEHKNGVLEEAIIATILKEVLEGLDYLHRNGQIHRDLKAGNILL</p>

<p>Purified Polyclonal PAK6 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DCX antibody, catalog no. 70R-5900</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KPNA2 antibody, catalog no. 70R-5497</p>

<p>Coronavirus Nucleoprotein (NP) monoclonal antibody</p>

<p>The 14-3-3 sigma antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets the 14-3-3 sigma protein, which plays a crucial role in various cellular processes. This antibody can be used to detect and quantify the expression levels of 14-3-3 sigma in different samples, such as cell lysates or tissue extracts.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CLPB antibody, catalog no. 70R-3955</p>

<p>ARIH2 antibody was raised in Rabbit using Human ARIH2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NCAPH2 antibody, catalog no. 70R-3003</p>

<p>Purified recombinant Human DYNLL1 protein</p>

<p>Rabbit polyclonal Clofibrate antibody</p>

<p>Donkey anti-human IgG (H + L) (Alk Phos) was raised in donkey using human IgG (H&amp;L) as the immunogen.</p>

<p>Fibrin Fragment E antibody (HRP) was raised in sheep using human Fibrin Fragment E purified from plasma lysate of crosslinked fibrin clot as the immunogen.</p>

<p>The NOX1 antibody is a highly specialized polyclonal antibody that targets the oncostatin receptor. It is designed to specifically bind to glial fibrillary acidic protein (GFAP), an antigen expressed in glial cells. This antibody can be used for various applications, including immunohistochemistry and western blotting, to detect the presence and localization of GFAP in tissues or cell cultures.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IRF6 antibody, catalog no. 70R-1620</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EBP antibody, catalog no. 70R-6689</p>

<p>C11ORF46 antibody was raised using the N terminal Of C11Orf46 corresponding to a region with amino acids SSNDMLLLQLRTGMTLSGNNTICFHHVKIYIDRFEDLQKSCCDPFNIHKK</p>

<p>Rabbit polyclonal UTP14A antibody</p>

<p>Purified recombinant Human SH2D1A protein</p>

<p>Affinity purified Rabbit polyclonal VPS37C antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NUSAP1 antibody, catalog no. 70R-2411</p>

<p>1-119 amino acids: MDKNIGEQLN KAYEAFRQAC MDRDSAVKEL QQKTENYEQR IREQQEQLSL QQTIIDKLKS QLLLVNSTQD NNYGCVPLLE DSETRKNNLT LDQPQDKVIS GIAREKLPKV DIASAESSI</p>

<p>Nidogen/Enactin Monoclonal Antibody</p>

<p>CYB5R1 antibody was raised in Rabbit using Human CYB5R1 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal SCN1B antibody</p>

<p>Affinity purified Rabbit polyclonal Cish antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of WNT5B antibody, catalog no. 70R-1563</p>

<p>The Angiotensinogen antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and neutralize angiotensinogen, a protein that plays a key role in the regulation of blood pressure and fluid balance in the body. This antibody has been extensively studied and proven to be effective in blocking the activation of angiotensinogen, thereby preventing its interaction with other molecules such as atrial natriuretic peptide and albumin.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of STAU1 antibody, catalog no. 70R-4913</p>

<p>DBF4 antibody was raised in Rabbit using Human DBF4 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PHF10 antibody, catalog no. 70R-2002</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Rnf183 antibody, catalog no. 70R-8560</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF433 antibody, catalog no. 70R-8904</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GJD3 antibody, catalog no. 70R-8184</p>

<p>alpha 1B Glycoprotein antibody was raised in Rabbit using Human alpha 1B Glycoprotein antibody as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ALKBH3 antibody, catalog no. 70R-3704</p>

<p>GABPA antibody was raised in Mouse using a purified recombinant fragment of human GABPA (aa120-190) expressed in E. coli as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FLJ14213 antibody, catalog no. 70R-1281</p>

<p>NCKIPSD antibody was raised in Rabbit using Human NCKIPSD as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SF3B14 antibody, catalog no. 70R-4706</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ADORA3 antibody, catalog no. 70R-9947</p>

<p>Copine I antibody was raised using the N terminal of CPNE1 corresponding to a region with amino acids TVQKLRFGIYDIDNKTPELRDDDFLGGAECSLGQIVSSQVLTLPLMLKPG</p>

<p>Rabbit anti-dog IgG (H+L) (Rhodamine) was raised in rabbit using canine IgG whole molecule as the immunogen.</p>

<p>KIAA1627 antibody was raised in rabbit using the N terminal of KIAA1627 as the immunogen</p>

<p>Rabbit polyclonal JNK antibody (Thr183)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TIPIN antibody, catalog no. 20R-1275</p>

<p>ATP6V1G1 antibody was raised in Rabbit using Human ATP6V1G1 as the immunogen</p>

<p>Protein C antibody is a highly specialized antibody that targets the activated form of protein C, an important regulator of blood coagulation. This antibody specifically recognizes the active form of protein C and can be used in various research applications, particularly in the field of life sciences.</p>

<p>Purified recombinant Human FDCSP protein (His tag)</p>

<p>HBsAg antibody (FITC) was raised in goat using subtypes ad &amp; ay as the immunogen.</p>

<p>Rabbit polyclonal CDK5R2 antibody</p>

<p>Purified Polyclonal TLK1 antibody</p>

<p>The CASP3 antibody is a highly effective antibody that plays a crucial role in various biological processes. It is a multidrug antibody that targets superoxide and steroid molecules, making it an essential tool in the field of life sciences. This antibody specifically binds to actin filaments, which are vital for cell structure and movement.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCNH2 antibody, catalog no. 70R-5165</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C17orf49 antibody, catalog no. 70R-3752</p>

<p>The Rb antibody is a highly specific monoclonal antibody that targets the retinoblastoma protein (Rb). This antibody is widely used in life sciences research, particularly in studies related to cell cycle regulation and cancer. The Rb antibody recognizes the phosphorylated form of Rb, which plays a critical role in controlling cell proliferation and differentiation. It has been extensively validated for use in various applications such as Western blotting, immunohistochemistry, and flow cytometry. With its high affinity and specificity, the Rb antibody provides researchers with a valuable tool for investigating the molecular mechanisms underlying cell growth and tumorigenesis.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DDX5 antibody, catalog no. 70R-1398</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZC3H15 antibody, catalog no. 70R-8951</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KIF2C antibody, catalog no. 70R-5591</p>

<p>Human ESE1 internal region immunogen; affinity purified Rabbit polyclonal ESE1 antibody</p>

<p>EXOC1 antibody was raised in Rabbit using Human EXOC1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PUF60 antibody, catalog no. 70R-4912</p>