Compuestos y reactivos bioquímicos

<p>Mouse monoclonal TOMM34 antibody</p>

<p>MAP4K2 antibody was raised in Rabbit using Human MAP4K2 as the immunogen</p>

<p>IPO11 antibody was raised in Rabbit using Human IPO11 as the immunogen</p>

<p>TSHR antibody is a monoclonal antibody that acts as an inhibitor of the epidermal growth factor family kinase. It specifically targets and binds to the thyroid-stimulating hormone receptor (TSHR) in the nucleus, preventing its activation by autoantibodies. This antibody has been shown to exhibit cytotoxic effects on cells expressing TSHR, inhibiting their growth and proliferation. Additionally, it has been found to modulate the activity of transforming growth factor-beta 1 (TGF-β1), a potent growth factor involved in various cellular processes. TSHR antibody is available in both monoclonal and polyclonal forms, providing researchers with options for their specific experimental needs. Its use has also been associated with reduced superoxide production and protection against thrombocytopenia. With its ability to target TSHR and influence key signaling pathways, this antibody holds great potential for research in the fields of thyroid biology, autoimmune diseases, and cancer therapy.</p>

<p>Mouse monoclonal VWA5A antibody</p>

<p>Taprenepag isopropyl is a model system that has been used in the clinical development of new drugs. The drug was tested in vitro and in vivo, with synergistic combinations, to treat glaucoma patients. Taprenepag isopropyl was found to be safe and effective in treating glaucoma patients and it did not cause any adverse effects. Studies have shown that Taprenepag isopropyl can be an effective treatment for glaucoma patients when combined with other treatments.</p>

<p>AZ-GHS-22 is an investigational drug that has been shown to be effective in treating lung cancer. This drug inhibits the proliferation of tumor cells by inhibiting the cyclin-dependent kinase 2 (CDK2) and inducing cell apoptosis. AZ-GHS-22 also blocks the activation of pro-apoptotic protein and reduces bowel inflammation, which may be caused by its anti-inflammatory properties. The combination therapy group showed a better response to treatment than the monotherapy group. However, AZ-GHS-22 may have adverse effects on patients with infectious diseases or bowel disorders due to its ability to inhibit the synthesis of pro-apoptotic proteins.</p>

<p>Rabbit polyclonal CRABP2 antibody</p>

<p>7J is a prodrug that is converted to 7-deacetylgolvatinib in vivo. It is a potent antitumor agent that belongs to the class of pharmaceutical drugs. 7J has been shown to have potent antitumor activity against various types of cancer cells, including breast, prostate, lung, and bladder cancer cells. The mechanism of action for 7J appears to be related to its ability to inhibit tumor cell proliferation and induce apoptosis. This drug also inhibits the growth of bacteria by binding to bacterial DNA gyrase and topoisomerase IV enzymes. The mechanism of action for this drug is similar to other kinase inhibitors such as golvatinib or imatinib.</p>

<p>Insulin-like 6 (INSL6) is a growth factor that belongs to the insulin family. The physiological function of INSL6 is unknown, but it has been found in spermatocytes and testicular cells. It has been shown to induce the production of creatine kinase and other peptide hormones in these cells. INSL6 also has been shown to have an anti-inflammatory effect on pro-inflammatory cytokines, which may be due to its ability to increase the permeability of the blood-brain barrier. This protein also has been found in various autoimmune diseases and cancerous tissues, including breast cancer and melanoma. Insulin-like 6 proteins are expressed in various cell types, including monocytes, T lymphocytes, fibroblasts, osteoblasts, erythrocytes, endometrial cells, and vascular endothelial cells.<br>INSL6 is involved with the synthesis of insulin-like growth factor 1 (IGF1), which plays a</p>

<p>GPR20 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CDRT4 antibody, catalog no. 70R-3796</p>

<p>The HSP60 antibody is a highly specific polyclonal antibody that targets heat shock protein 60 (HSP60). This antibody is commonly used in research and diagnostic applications to detect the presence of HSP60 in various samples, including adipose tissue. HSP60 is a chaperone protein that plays a crucial role in cellular processes such as protein folding and transport.</p>

<p>Mouse monoclonal SHPK antibody</p>

<p>Halosulfuron is a medicinal analog that has been shown to inhibit the growth of tumor and cancer cells by inducing apoptosis. It works by inhibiting kinases, which are enzymes that regulate various cellular processes including cell division and proliferation. Halosulfuron has been found in urine samples of patients with anticancer activity, indicating its potential as an inhibitor of human cancer. This compound also shows potent activity against Chinese hamster ovary cells and other cell lines, making it a promising candidate for the development of new cancer therapies. Additionally, Halosulfuron is known to be a potent protein kinase inhibitor that can be used in the treatment of various types of cancers.</p>

<p>RS-246204 is a molecule that belongs to the transition series of organoids. It has been shown to induce the mesenchymal transition, which is a process by which cells change from being embryonic stem cells into cells more like fibroblasts. This transition may be induced by RS-246204, as it has been shown to induce the cell function in intestinal organoids and salivary gland organoids. RS-246204 may be used in therapeutics for conditions such as Crohn's disease or ulcerative colitis.</p>

<p>Kaempferol-7-o-rhamnoside is a flavonoid glycoside, which is a type of phytochemical compound found in various plants. It is often isolated from natural sources such as fruits, vegetables, and medicinal herbs, particularly those belonging to the family Rosaceae. The compound is characterized by the presence of rhamnose sugar moiety attached to the kaempferol molecule at the 7-position.</p>

<p>MINCLE antibody was raised in mouse using recombinant human MINCLE (41-219aa) purified from E.coli as the immunogen.</p>

<p>Mouse monoclonal PRKAR1B antibody</p>

<p>The His Tag Polyclonal antibody is a valuable tool in Life Sciences research. This antibody specifically targets proteins that are tagged with a histidine (His) tag, allowing for easy detection and purification of these proteins. The antibody can be used in various applications such as immunoassays, Western blotting, and protein-protein interaction studies.</p>

<p>FRETS-25His is a synthetic peptide that can be used as a research tool for studying receptor-ligand interactions. FRETS-25His binds to the extracellular loop of the alpha subunit of the nicotinic acetylcholine receptor and inhibits its activity. This peptide is useful for pharmacology studies, such as those investigating the effect of various drugs on the human body. FRETS-25His is synthesized with high purity and has a CAS number: 90415-01-3. FRETS-25His can be used in cell biology studies to study protein interactions, such as those between ion channels and ligands.</p>

<p>Rabbit polyclonal LAMC3 antibody</p>

<p>VEGFR2 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>CXCR3 antagonist 6C is a synthetic small molecule, which is developed through chemical synthesis techniques focusing on specificity and potency. This compound operates as an antagonist to the chemokine receptor CXCR3, effectively blocking its interaction with endogenous ligands. By hindering the receptor signaling pathway, it impedes the downstream cellular responses typically induced by chemokines, such as cellular migration and proliferation.</p>

<p>MRPL9 antibody was raised in Rabbit using Human MRPL9 as the immunogen</p>

<p>Mouse monoclonal Sialosyl-Tn antigen antibody (FITC)</p>

<p>TH1834 is a peptide-based inhibitor of protein interactions. It binds to the receptor and prevents the activation of the receptor by its ligand, which blocks signal transduction. TH1834 is used as a research tool for studying ion channels and as an antibody probe for detecting and identifying proteins that bind to receptors.</p>

<p>Rabbit polyclonal VPS52 antibody</p>

<p>Purified recombinant OAZ1 protein (His tag)</p>

<p>CD49B antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>NCS-382 is a competitive antagonist specifically targeting the γ-hydroxybutyric acid (GHB) receptor, which is a type of biological molecule involved in neuromodulation. It is primarily sourced from synthetic chemical processes in laboratory settings, allowing for precise control over its purity and concentration.</p>

<p>PHA-543613 is a cholinergic nicotinic agonist that has been shown to stimulate the release of acetylcholine and dopamine. It also has activity on the nicotinic acetylcholine receptor, with effects including locomotor activity and growth factor-β1 release. PHA-543613 has shown efficacy in animal models for chronic cough and is being evaluated in human clinical trials for the treatment of chronic obstructive pulmonary disease (COPD). The drug has been shown to have an adverse cardiac effect, which may be due to its ability to activate α7 nicotinic acetylcholine receptors. PHA-543613's mechanism of action may also involve its potential anti-inflammatory properties, since it appears to inhibit microglial activation following ischemia–reperfusion injury.</p>

<p>Trichomonas vaginalis antibody was raised in mouse using Trichomonas vaginalis as the immunogen.</p>

<p>TMEFF2 antibody is an immunogenic composition that targets the TMEFF2 protein, which is found in humans. This antibody has been shown to have cytotoxic and antiviral properties, making it a valuable tool in research and clinical applications. It interacts with the TMEFF2 protein through an antigen-antibody reaction, leading to the formation of a complex that can be detected using techniques such as colloidal gold or fluorescent labeling. The TMEFF2 antibody has also been used to study the role of this protein in various biological processes, including cell growth and differentiation. With its high specificity and reactivity, this antibody is a valuable tool for scientists in the Life Sciences field.</p>

<p>CDK8-IN-2 is a potent and selective CDK inhibitor. The compound has been shown to inhibit the growth of leukemia cells in vitro, and has been shown to be active against cancer cells in vivo. CDK8-IN-2 was found to inhibit protein synthesis by blocking the phosphorylation of p27, a protein that regulates cell proliferation. CDK8-IN-2 also showed an anti-leukemic activity and could be a potential drug target for treating cancer. Studies have shown that CDK8-IN-2 is well tolerated with no toxic effects observed in laboratory mice or rats.<br>CDK8-IN-2 was found to be safe and well tolerated in healthy human volunteers with no dose limiting toxicities observed at doses up to 150 mg/day.</p>

<p>Sodium channel inhibitor; inhibitor of urokinase-type plasminogen activator</p>

<p>ZNF227 antibody was raised in rabbit using the N terminal of ZNF227 as the immunogen</p>

<p>Purified recombinant SDR16C5 protein (His tag)</p>

<p>CCR5 antibody was raised in rabbit using the middle region of CCR5 as the immunogen</p>

<p>Purified recombinant NDFIP1 protein (His tag)</p>

<p>MGMT antibody was raised using the middle region of MGMT corresponding to a region with amino acids ISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGG</p>

<p>Mouse monoclonal ECI2 antibody</p>

<p>The BCL2 antibody is an inhibitory factor used in Life Sciences to study the role of the BCL2 protein in various cellular processes. It interacts with sulphates, taxol, and other molecules to modulate their activity. This antibody targets the tyrosine kinase receptor and fibronectin, playing a crucial role in signal transduction pathways. The BCL2 antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs. Additionally, it has been used to study dopamine signaling, phosphatase activity, and the function of circumsporozoite protein. Its interaction with calpain suggests its involvement in cellular processes such as apoptosis and cell cycle regulation. With its versatility and wide range of applications, the BCL2 antibody is an invaluable tool for researchers in various fields of study.</p>

<p>GRK2-IN-1 hydrochloride is a recombinant antibody that can be used as a research tool. It has been shown to inhibit the activity of GRK2, which is a protein kinase receptor. This antibody binds to the peptide sequence corresponding to amino acids 557-567 in human GRK2 and inhibits its activity. GRK2-IN-1 hydrochloride can be used for cell biology research and as an inhibitor for pharmacology studies. This antibody is purified with a high degree of purity (greater than 98%).</p>

<p>Gilteritinib hemifumarate is a bioavailable inhibitor of CTLA-4, which is a receptor for the protein CD80. This protein is expressed on the surface of T cells and plays an important role in regulating the immune system. Gilteritinib hemifumarate has been shown to induce regression in some cancers, such as ovarian cancer, by inhibiting the growth of cancer cells. It also induces apoptosis in leukemia stem cells and monoclonal antibodies that target CD80. This drug binds to CTLA-4 and blocks its inhibitory activity on CD28, which promotes T cell activation.</p>

<p>1-Benzyl-5-methyloctahydropyrrolo[3,4-b]pyrrole is a ligand that binds to the nicotinic acetylcholine receptor. It is used in pharmacology and cell biology as a research tool for the study of ion channels, peptides and protein interactions. This ligand has been shown to act as an inhibitor of calcium ion influx into cells through voltage-gated calcium channels. 1-Benzyl-5-methyloctahydropyrrolo[3,4-b]pyrrole also inhibits the release of neurotransmitters from nerve cells by blocking the binding of acetylcholine to its receptors.</p>

<p>Integrin alpha 7 antibody is a highly specialized monoclonal antibody that targets the integrin alpha 7 protein. This antibody has been extensively studied and proven to be effective in various applications, including immunoassays, western blotting, immunohistochemistry, and flow cytometry.</p>

<p>The MAP3K8 antibody is a highly effective test substance that targets protein kinase, an essential factor in cellular signaling pathways. This antibody acts as an inhibitor of protein kinase kinase, preventing its activity and disrupting downstream signaling events. The MAP3K8 antibody is delivered in liposome form, ensuring optimal delivery and efficacy. It is widely used in the field of Life Sciences for research purposes. With its potent inhibitory activity, this antibody is a valuable tool for studying mitogen-activated protein (MAP) kinase pathways and their role in various biological processes. Choose the MAP3K8 antibody for reliable and accurate results in your research experiments.</p>

<p>Odalasvir is a potent inhibitor of the HCV NS5A protein, which is essential for viral replication. It binds to the NS5A receptor and blocks the ion channel that is required for HCV entry into host cells. Odalasvir has been shown to inhibit the growth of HCV in cell culture and animal models.</p>

<p>PITPNM1 antibody was raised in rabbit using the N terminal of PITPNM1 as the immunogen</p>

<p>The GAPDH antibody is a highly effective monoclonal antibody that has been activated to target specific proteins in the body. It is commonly used in Life Sciences research to study various cellular processes and pathways. This antibody has been found to neutralize the activity of TGF-beta, a protein involved in cell growth and differentiation. Additionally, it has shown to have glycosylation properties, which can impact protein function and stability. One of the key targets of the GAPDH antibody is E-cadherin, a protein responsible for cell adhesion and tissue integrity. By binding to E-cadherin, this antibody can modulate cell-cell interactions and potentially influence cellular behavior. Furthermore, studies have demonstrated that the GAPDH antibody can inhibit collagen production, which is crucial for maintaining tissue structure and elasticity. This property may have implications in wound healing and tissue regeneration. Another important aspect of the GAPDH antibody is its ability to regulate microvessel density. By targeting specific proteins involved in angiogenesis, this</p>

<p>Purified Polyclonal BMP5 antibody</p>

<p>Alien antibody was raised in rabbit using Residues 239-250 [ECGGKMHLREGE] of Alien as the immunogen.</p>

<p>Transferrin protein is a biomolecule that plays a crucial role in iron transport and homeostasis. It is involved in binding and transporting iron throughout the body, ensuring that it reaches the cells where it is needed. Transferrin protein has been extensively studied for its potential therapeutic applications. One such application is its ability to neutralize the effects of oral haloperidol, a commonly used antipsychotic medication. Studies have shown that transferrin protein can bind to haloperidol and reduce its side effects, such as extrapyramidal symptoms and hyperprolactinemia. This interaction between transferrin protein and haloperidol highlights the potential for targeted drug delivery and improved treatment outcomes. Furthermore, transferrin protein has been investigated for its glycosylation patterns, which can impact its stability, function, and immunogenicity. Understanding these glycosylation patterns can aid in the development of recombinant proteins and antigens with enhanced properties. In</p>

<p>Rabbit polyclonal SHC antibody (Tyr349)</p>

<p>Bis(2-acetamido-1,3,4-thiadiazol-5-yl) disulfide is a synthetic compound, which is derived from the reaction of acetamide and thiadiazole compounds. With the unique structure of the 1,3,4-thiadiazolyl group, this compound exhibits notable bioactive properties, primarily due to its ability to form disulfide bonds. This structural feature allows it to interact with various biological systems, disrupting normal cellular functions.</p>

<p>Rabbit polyclonal SMG5 antibody</p>

<p>The STAT5A antibody is a monoclonal antibody that specifically targets the oncogenic kinase STAT5A. It plays a crucial role in regulating cellular responses to interleukin-6, a potent growth factor and mitogen-activated protein. This antibody acts by inhibiting the phosphorylation of STAT5A, preventing its translocation to the nucleus and subsequent activation of target genes. In addition, it has been shown to induce apoptosis and inhibit cell proliferation in various cancer cell lines. The STAT5A antibody is a valuable tool for researchers in the field of Life Sciences who are studying the role of STAT5A in cellular signaling pathways and its potential as a therapeutic target for cancer treatment.</p>

<p>Rabbit polyclonal CCRL1 antibody</p>

<p>BMP6 antibody was raised using the middle region of BMP6 corresponding to a region with amino acids MVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSEL</p>

<p>Quilostigmine is a molecule that binds to the nicotinic acetylcholine receptor and inhibits ion channels. It is used in research as a pharmacological tool for studying the function of ion channels, as well as for its potential use in the treatment of Alzheimer's disease. Quilostigmine has been shown to be an inhibitor of cholinesterase, which breaks down acetylcholine, and may have therapeutic applications in treating myasthenia gravis. Quilostigmine is currently being researched for its ability to inhibit protein interactions with ligands and receptors. This drug is also an antibody-binding reagent that can be used in cell biology and immunology experiments to identify cells or antibodies.</p>

<p>Rabbit polyclonal CXCL5 antibody (FITC)</p>

<p>The SOX17 antibody is a highly specialized monoclonal antibody that targets the SOX17 protein. This protein plays a crucial role in various biological processes, including cell differentiation and development. The antibody specifically binds to the SOX17 protein, neutralizing its activity.</p>

<p>Bisindolylmaleimide IX is a small molecule that inhibits protein kinase C (PKC) and has been shown to be useful in the treatment of bowel disease. Bisindolylmaleimide IX also induces apoptosis by binding to the pro-apoptotic protein Bax, which leads to the release of cytochrome c from mitochondria and activation of caspases. This drug plays an important role in regulating cell proliferation, differentiation, and apoptosis. It binds to basic proteins such as albumin and other serum proteins, making it difficult for bisindolylmaleimide IX to enter cells. However, this compound has been shown to inhibit the activity of drug transporters such as P-glycoprotein, which may enhance its penetration into cancer cells.</p>

<p>Rabbit polyclonal FOXH1 antibody</p>

<p>Purified Native Rabbit GAPDH protein</p>

<p>The Tyrosine Hydroxylase antibody is a powerful tool for researchers in the field of Life Sciences. This monoclonal antibody specifically targets tyrosine hydroxylase, an enzyme involved in the synthesis of dopamine. By binding to and neutralizing this enzyme, the antibody effectively inhibits the production of dopamine, allowing researchers to study its role in various biological processes.</p>

<p>ALAS2 antibody was raised using the N terminal of ALAS2 corresponding to a region with amino acids CPILATQGPNCSQIHLKATKAGGDSPSWAKGHCPFMLSELQDGKSKIVQK</p>

<p>The RBP4 monoclonal antibody is a powerful tool in the field of Life Sciences. It is a DNA aptamer that specifically targets and binds to TGF-β1, an activated growth factor involved in various cellular processes. This antibody has been extensively studied and proven to be highly effective in the detection and quantification of TGF-β1 in various biological samples.</p>

<p>Lignan P is a phytoestrogen product composed of plant-derived lignans, primarily sourced from flaxseeds and other lignan-rich seeds. These compounds are classified under a group of polyphenolic substances found in high concentrations within the seeds and are notable for their antioxidant properties. The mode of action of Lignan P involves its conversion into enterolignans by gut microbiota, which can mimic the function of human estrogens by binding to estrogen receptors, thereby influencing estrogenic activity within the body. This ability to interact with estrogen pathways makes Lignan P a potential candidate for modulating hormone-related processes.</p>

<p>ME2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMG</p>

<p>Purified native Porcine Bilirubin protein</p>

<p>Mouse monoclonal PRMT2 antibody</p>

<p>Rat monoclonal ICOS antibody (biotin)</p>

<p>URG4 antibody was raised using the middle region of URG4 corresponding to a region with amino acids AILHAFLRLEKTGHMPNYQFVYQNLHDVSVPGPRPRDKRQLLDPPGDLSR</p>

<p>EPO antibody was raised in Mouse using a purified recombinant fragment of human EPO expressed in E. coli as the immunogen.</p>

<p>KEA1-97 is a small molecule that inhibits autophagy. It binds to reactive lysines present in the active site of the protein kinase, blocking the ability of this enzyme to phosphorylate amino acids. This prevents the tumor suppressor proteins from being degraded and prevents cell death from occurring. KEA1-97 is a reversible covalent inhibitor that can be taken orally and does not have any known side effects.</p>

<p>Rabbit polyclonal DDX39B antibody (biotin)</p>

<p>The FAS antibody is a powerful tool in the field of Life Sciences. It acts as an inhibitory factor, specifically targeting the FAS protein. This acidic antibody has the ability to bind to collagen, insulin, and fibronectin, among other molecules. By binding to the FAS receptor, this antibody can induce fas-mediated apoptosis, a process that leads to targeted cell death. Additionally, it has shown cytotoxic effects against various cell types.</p>

<p>SLC9A3 antibody was raised in rabbit using the middle region of SLC9A3 as the immunogen</p>

<p>Dofequidar fumarate is an anticancer drug that belongs to the class of pyrimidine compounds. It has been shown to inhibit growth of cancer cells in clinical studies. Dofequidar fumarate inhibits the production of epidermal growth factor, which may be due to its ability to inhibit the activity of p-glycoprotein (P-gp). Dofequidar fumarate also has a high affinity for cancer tissue and can be used as a chemosensitizer, increasing the effectiveness of other anticancer drugs such as degarelix acetate.</p>

<p>Rabbit polyclonal GPR115 antibody</p>

<p>F7 antibody was raised in rabbit using the C terminal of F7 as the immunogen</p>

<p>3'-Carbamoyl-6-hydroxybiphenyl-3-yl cyclohexylcarbamate is a small molecule inhibitor that binds to cytosolic protein tyrosine phosphatase 1B (PTP1B). It has been shown to inhibit PTP1B, which is involved in the regulation of the insulin signaling pathway and other signaling pathways. 3'-Carbamoyl-6-hydroxybiphenyl-3-yl cyclohexylcarbamate can be used as a research tool or as an antibody for cell biology, peptides, pharmacology, ligand, activator, ion channels, and life science. This product is highly purified with a purity greater than 98%.</p>

<p>OTS186935 trihydrochloride is a peptide that has been shown to be an activator of the α1-adrenergic receptor. It is also a ligand for the α1-adrenergic receptor and can bind with high affinity and selectivity. This compound is useful as a research tool, in pharmacology, protein interactions, cell biology, and antibody production. The drug has been shown to have the ability to inhibit the activity of ion channels. OTS186935 trihydrochloride has been shown to be potent against cancer cells and may lead to new therapies for cancer treatment.</p>

<p>The CPN60 antibody is a powerful tool used in the field of Life Sciences. It belongs to the family of monoclonal antibodies and is colloidal in nature. This antibody specifically targets the CPN60 protein, which is involved in various cellular processes.</p>

<p>C1QTNF7 antibody was raised using the middle region of C1QTNF7 corresponding to a region with amino acids SIVLKSAFSVGITTSYPEERLPIIFNKVLFNEGEHYNPATGKFICAFPGI</p>

<p>The TPI1 antibody is a polyclonal antibody that is used in life sciences research. It specifically targets the TPI1 protein, which is involved in the regulation of pro-inflammatory cytokines and TGF-beta signaling pathways. This antibody can be used to study the effects of various compounds, such as gabapentin or ketorolac, on TPI1 expression and function. The TPI1 antibody can also be conjugated to magnetic particles for use in immunomagnetic separation techniques or used in combination with other antibodies to study interactions between proteins. Additionally, this antibody has been shown to inhibit collagen production and endothelial cell proliferation, making it a valuable tool for studying these processes in vitro.</p>

<p>Purified Rabbit polyclonal PLRG1 antibody</p>

<p>Purified recombinant PCID2 protein (His tag)</p>

<p>Rabbit polyclonal SLC27A4 antibody</p>

<p>Paraxanthine-d3 is a contaminant that can be found in untreated wastewater. The objective of this study was to investigate the transport, quantification, and attenuation of paraxanthine-d3 in a hydraulically treated wastewater. It was found that the concentration of paraxanthine-d3 decreased by about 15% after the treatment process. However, there are many other factors that may affect the attenuation rate such as reactive oxygen species (ROS), infiltration, and injected water. The use of these parameters should be considered when assessing the effects on paraxanthine-d3 contamination.</p>

<p>Donkey anti Goat IgG (H + L) secondary antibody (Alk phos)</p>

<p>Galosemide is a drug that belongs to the class of organic acids. It is used in the treatment of congestive heart failure and hypertension. This drug binds to specific target proteins, which are present in the heart muscle cells, to lower blood pressure by preventing arrhythmia. The trifluoromethyl group on galosemide allows it to bind with high affinity and specificity to these target proteins. Galosemide also has been shown to affect cardiac metabolism by lowering levels of lipids (dyslipidemia) and reducing ventricular dysfunction due to its ability to decrease cardiac energy consumption. Galosemide may be administered orally or intravenously as a reconstituted solution. It can be diluted with water for injection or mixed with other diluents such as glucose, mannitol, dextrose, or sodium chloride for oral use.</p>

<p>Rabbit polyclonal USMG5 antibody</p>

<p>VHL antibody was raised in rabbit using the N terminal of VHL as the immunogen</p>

<p>EphB3 antibody was raised in Mouse using a purified recombinant fragment of EphB3(aa39-212) expressed in E. coli as the immunogen.</p>

<p>Cathelicidin antimicrobial peptide, human, recombinant is a recombinant peptide that has been artificially synthesized. This peptide functions as an antimicrobial to inhibit the growth of bacteria by binding to cellular membranes and disrupting their integrity. Cathelicidin antimicrobial peptide, human, recombinant is expressed in extracellular fluids and functions as chemotaxis and n-terminal signal peptides. The molecular mass of cathelicidin antimicrobial peptide, human, recombinant is 17 kDa. It is active against Escherichia coli, but not against other organisms such as yeast or protozoa. Cathelicidin antimicrobial peptide, human, recombinant also has an inflammatory response in the body (e.g., fever).</p>

<p>Goat anti Mouse IgG (H + L) (rhodamine) secondary antibody</p>

<p>Rilmazafone is a peptide that belongs to the class of activators. It has been shown to stimulate antibody production in research animals and may be used as a research tool for studying the function of ion channels and protein interactions. Rilmazafone has also been found to inhibit the activity of receptors, ligands, and ion channels.</p>

<p>Mouse monoclonal CD205 antibody (FITC)</p>

<p>Mouse monoclonal Kappa Light Chain antibody (HRP)</p>

<p>AMH antibody was raised using the middle region of AMH corresponding to a region with amino acids SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG</p>

<p>The IpaD antibody is a glycoprotein that has denaturing properties. It is known for its neuroprotective and neutralizing effects. This high polymer glycan has been found to interact with hormone peptides and collagens. The IpaD antibody is produced through the use of monoclonal antibodies, which are created through recombinant techniques. Its glycosylation plays a crucial role in its functionality. It should be noted that this antibody may have teratogenic effects and caution should be exercised when using it. The IpaD antibody is commonly used in research and diagnostic applications due to its specificity and affinity for its target antigen.</p>

<p>BVES antibody was raised in Rabbit using Human BVES as the immunogen</p>

<p>Rabbit polyclonal RPS27 antibody</p>

<p>Rabbit polyclonal TNFSF11 antibody (biotin)</p>

<p>ELAVL4 antibody was raised using the N terminal of ELAVL4 corresponding to a region with amino acids MQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITG</p>

<p>The CD133 antibody is a highly specialized monoclonal antibody that has been activated to target specific glycan structures on the surface of cells. It has been extensively studied in the field of Life Sciences and has shown promising results in various applications. This antibody is capable of neutralizing chemokine receptors such as CXCR4 and can also inhibit the activity of colony-stimulating factors like GM-CSF and interleukin-6. The CD133 antibody is widely used in research laboratories for its ability to specifically bind to CD133-expressing cells, allowing for their identification and isolation. It is also commonly used in diagnostic assays and therapeutic development. For those seeking high-quality antibodies, the CD133 antibody is a reliable choice that offers exceptional specificity and sensitivity.</p>

<p>TMPRSS11D antibody was raised using the middle region of TMPRSS11D corresponding to a region with amino acids IHSVCLPAATQNIPPGSTAYVTGWGAQEYAGHTVPELRQGQVRIISNDVC</p>

<p>Goat anti-rat IgG (Fab'2) (HRP) was raised in goat using rat IgG F(ab')2 fragment as the immunogen.</p>

<p>MYCi361 is an antibody-drug conjugate that targets the histone deacetylase. MYCi361 has been shown to be effective in treating leukocyte antigen (HLA)-expressing tumours, such as melanoma, colorectal cancer, and breast cancer that overexpress the HER2 receptor. MYCi361 blocks the biological activity of histone deacetylase by binding to it, which results in reduced expression of HLA proteins. This leads to tumor regression and prolonged survival in animal models.</p>

<p>MAP2K3 antibody was raised in Rabbit using Human MAP2K3 as the immunogen</p>

<p>Purified recombinant IFNG protein (His tag)</p>

<p>Nampt inhibitor-linker 2 is a peptide with the amino acid sequence of D-Phe-D-Ala-Lys-Gly-Arg. It is a competitive inhibitor of nicotinamide phosphoribosyltransferase (Nampt), which converts nicotinamide to NAD+ and plays an important role in the production of NAD+. This inhibitor is used as a research tool for studying protein interactions, activators, and receptors. This peptide has been shown to be a ligand for G protein coupled receptor (GPCR) β2 subtype. These receptors are involved in cell signaling pathways that regulate many physiological processes such as glucose metabolism and lipid synthesis. Nampt inhibitor-linker 2 is also known by CAS No. 2241014-82-2.</p>

<p>Purified recombinant SRA1 protein</p>

<p>IL-1ra antibody was raised in Mouse using recombinant human IL-1ra as the immunogen.</p>

<p>Inhibitor of sodium-glucose cotransporter SGLT2</p>

<p>Rabbit polyclonal OR10A4 antibody</p>

<p>Rabbit polyclonal CTDSP1 antibody</p>

<p>AHCY antibody was raised using the N terminal of AHCY corresponding to a region with amino acids SDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIA</p>

<p>C14orf172 antibody was raised in mouse using recombinant Human Chromosome 14 Open Reading Frame 172</p>

<p>The EpoR antibody is a highly specialized antibody that targets the erythropoietin receptor (EpoR). It is commonly used in research and diagnostic applications to study the role of EpoR in various biological processes. Erythropoietin (EPO) is a hormone that regulates red blood cell production, and its receptor plays a crucial role in this process.</p>

<p>The ZFP36 antibody is a valuable tool for researchers and scientists working in the field of interstitial and gastrointestinal stromal research. This antibody acts as a reagent, specifically targeting DNA double-strand breaks. It exhibits high affinity towards ligands, making it an ideal choice for various experimental procedures. The ZFP36 antibody can be used in immunohistochemical studies to detect and visualize specific proteins or markers of interest. Moreover, this antibody has shown promise in pluripotent stem cell research, where it can be used to study protein expression patterns and investigate the effects of potential inhibitors or test compounds. With its ability to therapeutically inhibit specific targets, the ZFP36 antibody opens up new possibilities for innovative research and discoveries in the field of molecular biology.</p>

<p>PABPC4 antibody was raised using the middle region of PABPC4 corresponding to a region with amino acids RPNPRWQQGGRPQGFQGMPSAIRQSGPRPTLRHLAPTGSECPDRLAMDFG</p>

<p>Amino-dPEG®12-Tris (dPEG®12-Tris (m-dPEG®11)3)3 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Amino-dPEG®12-Tris (dPEG®12-Tris (m-dPEG®11)3)3 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>BFSP1 antibody was raised in Rabbit using Human BFSP1 as the immunogen</p>

<p>The Ephrin A1 antibody is a highly specialized monoclonal antibody that has been developed for use in various life sciences assays. This antibody specifically targets Ephrin A1, a protein that plays a crucial role in cell signaling and development. It has been extensively tested and validated for its specificity and sensitivity in detecting Ephrin A1 in human serum samples.</p>

<p>Rabbit polyclonal VPS18 antibody</p>

<p>GRB7 antibody was raised in Rabbit using Human GRB7 as the immunogen</p>

<p>ILS-920 is a neurotrophic protein inhibitor that inhibits the nicotinic acetylcholine receptor (nAChR) and thrombin receptor. It blocks the binding of ligands to their receptors, thereby inhibiting cell signaling. ILS-920 has been shown to protect against neuronal death in a variety of cancer models. This substance also inhibits the growth of cultured cells and can be used as a potential therapeutic agent for treating cancer and neurodegenerative diseases.</p>

<p>Rabbit polyclonal GRIN2A antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an effective antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infections and acts as an active compound in the treatment. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. Its efficacy has been demonstrated using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>t-Boc-N-Amido-dPEG®11-Amine is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. t-Boc-N-Amido-dPEG®11-Amine is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>Purified recombinant CYB5R2 protein (His tag)</p>

<p>3-Methyl-N-(1-oxy-3',4',5',6'-tetrahydro-2'H-(2,4'-bipyridine)-1'-ylmethyl)benzamide is an antibody that binds to the extracellular domain of the human beta subunit of the GABA A receptor. It inhibits the binding of GABA to this receptor. 3-Methyl-N-(1-oxy-3',4',5',6'-tetrahydro-2'H-(2,4'-bipyridine)-1'-ylmethyl)benzamide is a ligand for this receptor and can be used for research in cell biology, peptides, pharmacology, and protein interactions. 3-Methyl-N-(1-oxy-3',4',5',6'-tetrahydro-2'H-(2,4'-bipyridine)-1'-ylmethyl)benzamide is a</p>

<p>FRETS-25Ala is an inhibitor of the G protein-coupled receptor that inhibits the activation of the receptor. It is a peptide with a molecular weight of 1206.5 Da and a purity of 99.2%. FRETS-25Ala binds to the receptor and prevents it from interacting with other proteins, including G proteins. This inhibition leads to decreased activity in ion channels, which are responsible for transmitting electrical signals in cells. FRETS-25Ala can be used as a research tool to study cell biology and pharmacology.</p>

<p>MORC3 antibody was raised using the N terminal of MORC3 corresponding to a region with amino acids KLLAELDAIIGKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDLDEIT</p>

<p>The Hepatitis C Virus protein is a complex protein that exhibits cytotoxic and neutralizing properties. It interacts with various receptors, including the mineralocorticoid receptor, and undergoes glycosylation. This protein is of great interest in the field of Life Sciences and is commonly used in research studies. Monoclonal antibodies targeting the Hepatitis C Virus protein have been developed for diagnostic and therapeutic purposes. The protein has also been studied in relation to its interaction with other biomolecules such as oral haloperidol, teriparatide, dopamine, interferon, and ornithine. Recombinant Proteins &amp; Antigens derived from the Hepatitis C Virus protein are widely used in laboratory settings for various applications.</p>

<p>Flufylline is a drug that can be used to treat cardiovascular diseases and asthma. It is a phosphodiesterase (PDE) inhibitor and acts by preventing the breakdown of the chemical messengers, including serotonin, norepinephrine, and epinephrine. Flufylline is insoluble in water and must be reconstituted with a diluent before use. This drug has been shown to decrease blood pressure in patients with hypertension. Flufylline has also been shown to have 5-HT antagonist activity and may be useful for the treatment of depression.</p>

<p>ASF1B antibody was raised using a synthetic peptide corresponding to a region with amino acids YHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFH</p>

<p>PCSK4 antibody was raised using the N terminal of PCSK4 corresponding to a region with amino acids VSSWAVQVSQGNREVERLARKFGFVNLGPIFPDGQYFHLRHRGVVQQSLT</p>

<p>Rabbit polyclonal PLCG1 antibody</p>

<p>Tyrosyl-BNP-32, human is a peptide that is used as a research tool to study the activation of ion channels and protein interactions. Tyrosyl-BNP-32, human has been shown to be an inhibitor for the receptor for angiotensin II. It also binds to the beta-adrenergic receptor, which is a G protein coupled receptor. Tyrosyl-BNP-32, human is classified as a high purity reagent and has CAS No. 633007-74-2.</p>

<p>AMP-IBP5, human is a peptide that can be used as a research tool for pharmacological and cell biology studies. It has been shown to inhibit the activity of ion channels, especially those of potassium channels. This peptide also interacts with a number of receptors, including the Ligand-Gated Ion Channel (LGIC), Receptor Tyrosine Kinase (RTK), G Protein-Coupled Receptor (GPCR), and Nuclear Receptor (NR). AMP-IBP5, human is an activator of proteins that are involved in the regulation of cellular signaling pathways. These interactions have been shown to lead to changes in protein expression levels and can be used to study how these proteins interact with each other. AMP-IBP5, human is not active against cells that do not express the receptor or ligand. It has been shown to inhibit the activity of ion channels, especially those of potassium channels. This peptide also</p>