Compuestos y reactivos bioquímicos

<p>Calicin antibody was raised in Guinea Pig using synthetic N-terminal domain of bovine calicin coupled to KLH as the immunogen.</p>

<p>Recombinant human MPI protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MLN antibody, catalog no. 70R-6243</p>

<p>Thrombospondin antibody is a powerful tool used in Life Sciences research to study various biological processes. It specifically targets and detects the presence of thrombospondin, a protein involved in cell growth, angiogenesis, and wound healing. This antibody can be used in various applications such as immunohistochemistry, Western blotting, and enzyme-linked immunosorbent assay (ELISA). By binding to thrombospondin, this antibody allows researchers to investigate its role in different cellular pathways and understand its interactions with other molecules like epidermal growth factor (EGF), alpha-fetoprotein, serotonin, and c-myc. With its high specificity and sensitivity, the thrombospondin antibody provides valuable insights into the molecular mechanisms underlying these processes.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UGCG antibody, catalog no. 70R-7359</p>

<p>Pnkd antibody was raised in rabbit using the N terminal of Pnkd as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DGAT2L7 antibody, catalog no. 70R-8809</p>

<p>AGT antibody was raised in Mouse using a purified recombinant fragment of human AGT expressed in E. coli as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CAMK1G antibody, catalog no. 70R-4088</p>

<p>Affinity purified Rabbit polyclonal CNGA2 antibody</p>

<p>CCDC127 antibody was raised using the N terminal of CCDC127 corresponding to a region with amino acids LGLAAFRWIWSRESQKEVEKEREAYRRRTAAFQQDLEAKYHAMISENRRA</p>

<p>ARL2BP antibody was raised in Rabbit using Human ARL2BP as the immunogen</p>

<p>Affinity purified Rabbit polyclonal PHKA2 antibody</p>

<p>Region of GCSF protein corresponding to amino acids MVPLVTVSAL PPSLPLPRSF LLKSLEQVRK IQASGSVLLE QLCATYKLCH PEELVLLGHS LGIPKASLSG CSSQALQQTQ CLSQLHSGLC LYQGLLQALS GISPALAPTL DLLQLDVANF ATTIWQQMEN LGVAPTVQPT QSAMPAFTSA FQRRAGGVLA ISYLQGFLET ARLALHHLA.</p>

<p>The ASK1 antibody is a highly specialized protein that plays a crucial role in various biological processes. It acts as a colony-stimulating factor, promoting the growth and development of cells in adipose tissue. The ASK1 antibody has been extensively studied and proven to have significant effects on cell growth and differentiation.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CDCA5 antibody, catalog no. 70R-2882</p>

<p>The Lp-PLA2 antibody is a cytotoxic antibody that targets choline acetyltransferase, an enzyme involved in the synthesis of acetylcholine. It has been shown to inhibit the growth of cancer cells by blocking the activity of cholinergic signaling pathways. This monoclonal antibody specifically binds to the epidermal growth factor receptor (EGFR) and inhibits its activation, leading to decreased cell proliferation and increased apoptosis. The Lp-PLA2 antibody has also been found to have anti-androgenic effects, making it a potential therapeutic option for hormone-dependent cancers. Additionally, this antibody has shown promising results in reducing thrombocytopenia, a condition characterized by low platelet count.</p>

<p>IL2 antibody (Mouse) was raised in Mouse using a purified recombinant fragment of IL2 expressed in E. coli as the immunogen.</p>

<p>Vimentin antibody was raised in Mouse using a purified recombinant fragment of Vimentin(aa2-466) expressed in E. coli as the immunogen.</p>

<p>DOK4 antibody was raised in Rabbit using Human DOK4 as the immunogen</p>

<p>CD45 antibody was raised in Mouse using a purified recombinant fragment of CD45 expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal Mnk1 antibody (Thr385)</p>

<p>Rabbit polyclonal IL12B antibody (FITC)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HBP1 antibody, catalog no. 70R-8293</p>

<p>PNMA6A antibody was raised in rabbit using the N terminal of PNMA6A as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EVX1 antibody, catalog no. 70R-9567</p>

<p>The TIMP1 antibody is a highly specific and sensitive tool used in Life Sciences research. It is an antibody that specifically targets and binds to TIMP1, which stands for Tissue Inhibitor of Metalloproteinase 1. TIMP1 is a protein that plays a crucial role in regulating the activity of enzymes known as metalloproteinases, which are involved in various biological processes including tissue remodeling, angiogenesis, and cell migration.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC18A1 antibody, catalog no. 70R-8078</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TPM1 antibody, catalog no. 70R-1073</p>

<p>The HLADR antibody is a highly specialized monoclonal antibody that is used in the field of Life Sciences. It is designed to specifically bind to the HLADR receptor, which plays a crucial role in immune system function. This antibody has been extensively tested and shown to have high affinity and specificity for its target.</p>

<p>GSK3B antibody was raised in Mouse using a purified recombinant fragment of human GSK3B expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal VOPP1 antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of JPH1 antibody, catalog no. 70R-6898</p>

<p>The STAT6 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to the STAT6 protein, which is involved in various cellular processes. This antibody has been shown to be effective in neutralizing the activity of activated STAT6, preventing its interaction with other proteins and inhibiting downstream signaling pathways. Additionally, the STAT6 antibody has been found to inhibit the binding of fibrinogen and chemokines, thereby reducing inflammation. It also shows potential as an anti-mesothelin antibody, targeting a protein often overexpressed in certain cancers. Furthermore, this antibody has demonstrated antiviral activity by blocking viral entry into cells. Its ability to neutralize growth factors makes it a valuable tool for studying cell proliferation and differentiation processes. In summary, the STAT6 antibody is a versatile research tool with diverse applications in various fields of study within the Life Sciences domain.</p>

<p>Factor VII antibody (FITC) was raised in sheep using human Factor VII purified from plasma as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C1D antibody, catalog no. 70R-8924</p>

<p>Gemin 3 Monoclonal Antibody</p>

<p>Goat anti human IgG is a highly effective inhibitor that targets antibodies, specifically sorafenib, in human serum. It has been extensively studied and proven to be effective in various applications, including electrochemical impedance in Life Sciences and immunoassays. This inhibitor works by blocking the activity of phosphatase, preventing the dephosphorylation of target proteins. Additionally, it can be used as a solubilizing agent for monoclonal antibodies, ensuring their stability and functionality. Goat anti human IgG is commonly used in research laboratories and pharmaceutical industries due to its high specificity and reliability. With its ability to bind to glycoproteins and induce fas-mediated apoptosis, this product offers a wide range of possibilities for experimental studies and therapeutic applications.</p>

<p>The THBS2 antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets and binds to CD33, a receptor protein involved in various biological processes. It can be used for research purposes, such as studying receptor binding and identifying binding proteins. Additionally, the THBS2 antibody has applications in diagnostics and therapeutics.</p>

<p>Twf1 antibody was raised in rabbit using the C terminal of Twf1 as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by inhibiting bacterial growth through the binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its high frequency of human activity has been demonstrated using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>ALDH7A1 antibody was raised in Rabbit using Human ALDH7A1 as the immunogen</p>

<p>Region of CYR61 protein corresponding to amino acids MTCPAACHCP LEAPKCAPGV GLVRDGCGCC KVCAKQLNED CSKTQPCDHT KGLECNFGAS STALKGICRA QSEGRPCEYN SRIYQNGESF QPNCKHQCTC IDGAVGCIPL CPQELSLPNL GCPNPRLVKV TGQCCEEWVC DEDSIKDPME DQDGLLGKEL GFDASEVELT RNNELIAVGK GSSLKRLPVF GMEPRILYNP LQGQKCIVQT TSWSQCSKTC GTGISTRVTN DNPECRLVKE TRICEVRPCG QPVYSSLKKG KKCSKTKKSP EPVRFTYAGC LSVKKYRPKY CGSCVDGRCC TPQLTRTVKM RFRCEDGETF SKNVMMIQSC KCNYNCPHAN EAAFPFYRLF NDIHKFRD.</p>

<p>Troponin I antibody is a highly specific monoclonal antibody that is commonly used in the field of Life Sciences. It is activated by isothiocyanate and has shown great efficacy in detecting troponin I, a protein found in cardiac muscle cells. This antibody binds to troponin I and can be used for various applications, including research, diagnostic tests, and therapeutic treatments. Additionally, it has been shown to have inhibitory effects on steroid synthesis and dopamine release. The monoclonal nature of this antibody ensures high specificity and sensitivity, making it a valuable tool in the study of cardiac function and related disorders.</p>

<p>Region of IL6 protein corresponding to amino acids MFPTSQVRRG DFTEDTTPNR PVYTTSQVGG LITHVLWEIV EMRKELCNGN SDCMNNDDAL AENNLKLPEI QRNDGCYQTG YNQEICLLKI SSGLLEYHSY LEYMKNNLKD NKKDKARVLQ RDTETLIHIF NQEVKDLHKI VLPTPISNAL LTDKLESQKE WLRTKTIQFI LKSLEEFLKV TLRSTRQT.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CCNDBP1 antibody, catalog no. 70R-9324</p>

<p>FAK antibody is a monoclonal antibody that specifically targets focal adhesion kinase (FAK). FAK is a protein involved in cell signaling pathways and plays a crucial role in cell adhesion, migration, and proliferation. This antibody binds to FAK and inhibits its activity, leading to the disruption of focal adhesions and impairing cancer cell growth and metastasis. Additionally, FAK antibody has been shown to have therapeutic potential in targeting other diseases such as autoimmune disorders. It can be used for research purposes in life sciences or as a diagnostic tool to detect the presence of FAK in human serum samples. With its high specificity and affinity, this antibody provides valuable insights into understanding cellular processes and developing novel therapeutic strategies.</p>

A synthetic peptide for use as a blocking control in assays to test for specificity of EIF3M antibody, catalog no. 70R-1252

<p>Purified Polyclonal N4BP1 antibody</p>

<p>The p90RSK antibody is a cytotoxic monoclonal antibody that targets the p90 ribosomal S6 kinase (p90RSK). It is commonly used in research to study growth factors, such as hepatocyte growth factor. This antibody has been shown to inhibit the activity of p90RSK, which is involved in multiple cellular processes including cell proliferation and survival. The p90RSK antibody can be used in various applications such as Western blotting, immunohistochemistry, and flow cytometry. It has also been shown to bind to other proteins such as collagen, creatine kinase, fibronectin, and retinoid receptors. This antibody may have potential therapeutic applications due to its ability to target specific proteins involved in disease pathways.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RBBP4 antibody, catalog no. 70R-5611</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MTPN antibody, catalog no. 70R-2590</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DHDH antibody, catalog no. 70R-4443</p>

<p>Please enquire for more information about L-Lysyl-L-cysteine trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NUMA1 antibody, catalog no. 70R-8922</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PHF6 antibody, catalog no. 20R-1278</p>

<p>Purified Polyclonal GPR82 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PSMD10 antibody, catalog no. 70R-4328</p>

<p>CSN3 antibody was raised in rabbit using the N terminal of CSN3 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UBE2K antibody, catalog no. 70R-2724</p>

<p>Affinity purified Rabbit polyclonal MUS81 antibody</p>

<p>Purified Sheep IgG (Fc) HRP conjugate</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GNB4 antibody, catalog no. 70R-9512</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAF antibody, catalog no. 70R-8267</p>

<p>Purified recombinant Human EIF2B1 protein</p>

<p>LAT antibody is a monoclonal antibody that specifically targets the protein kinase LAT (linker for activation of T cells). It recognizes and binds to the tyrosine residues of LAT, preventing its phosphorylation and subsequent activation of downstream signaling pathways. This antibody can be used in various applications such as immunoprecipitation, Western blotting, and flow cytometry. The LAT antibody is highly specific and exhibits strong affinity towards its target. It has been extensively validated in different experimental settings, ensuring reliable and reproducible results. Additionally, this antibody has neutralizing properties, making it a valuable tool for studying the role of LAT in T cell activation and immune responses. Whether you're conducting research in Life Sciences or developing therapeutic interventions, the LAT antibody is an indispensable resource for understanding cellular signaling mechanisms and designing targeted therapies.</p>

<p>RAB3IP antibody was raised using a synthetic peptide corresponding to a region with amino acids APCSTSGVTAGLTKLTTRKDNYNAEREFLQGATITEACDGSDDIFGLSTD</p>

<p>IL6 antibody was raised in rabbit using highly pure recombinant murine IL-6 as the immunogen.</p>

<p>C17orf75 antibody was raised using the N terminal of C17orf75 corresponding to a region with amino acids SSHYCLYSYRGSRLAQQRGDSEDGSPSGTNAETPSGDDFSLSLADTNLPS</p>

<p>Rabbit polyclonal Chicken Serum Albumin antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC25A46 antibody, catalog no. 70R-6512</p>

<p>The CD22 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target the CD22 protein, which plays a crucial role in immune response regulation. This antibody can be used for various applications, including the study of tyrosine signaling pathways, the development of recombinant proteins, and the identification of growth factor inhibitors.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RAB15 antibody, catalog no. 70R-5831</p>

<p>Rabbit polyclonal PLA2G2A antibody</p>

<p>KCND3 antibody was raised using the middle region of KCND3 corresponding to a region with amino acids KARLARIRVAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIE</p>

<p>The BRCA1 antibody is a mouse monoclonal antibody that specifically targets the BRCA1 protein. This protein is involved in DNA repair and plays a crucial role in preventing the development of certain types of cancer, particularly breast and ovarian cancer. The BRCA1 antibody has been extensively used in immunochemical studies to detect and quantify the presence of BRCA1 in various biological samples, including human serum, blood plasma, and tissue sections. It can be utilized in techniques such as immunohistochemistry, Western blotting, and ELISA. The high affinity and specificity of this monoclonal antibody make it an invaluable tool for researchers in the field of Life Sciences who are studying the functions and mechanisms of BRCA1.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LNX1 antibody, catalog no. 70R-1566</p>

<p>The E.Coli derived recombinant mosaic protein contains the HHV-4 EBNA regions, 1-90, 408-498 amino acids, the Mw is 46kDa (including 26kDa GST tag).</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SCCPDH antibody, catalog no. 70R-7071</p>

<p>Prp19p antibody was raised in Guinea Pig using synthetic C-terminal peptide of human Prp19p as the immunogen.</p>

<p>The BCL2 antibody is a powerful tool in the field of life sciences. This antibody specifically targets the B-cell lymphoma 2 (BCL2) protein, which plays a crucial role in regulating cell survival and apoptosis. By binding to the BCL2 protein, this antibody can inhibit its activity and induce cytotoxic effects in cancer cells.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FMO4 antibody, catalog no. 70R-6252</p>

<p>DDX19B antibody was raised using a synthetic peptide corresponding to a region with amino acids DEQEAAAESLSNLHLKEEKIKPDTNGAVVKTNANAEKTDEEEKEDRAAQS</p>

<p>Affinity purified Rabbit polyclonal Docking protein 3 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA1600 antibody, catalog no. 70R-4079</p>

<p>Cystatin C protein is a buffered solution that plays a crucial role in various biological processes. It acts as an inhibitor of cysteine proteases and regulates the activity of these enzymes. Cystatin C is involved in the regulation of brain natriuretic peptide, which plays a role in cardiovascular health. Additionally, it has been shown to have nuclear growth factor-like activity and can promote cell proliferation and differentiation.</p>

<p>AP2B1 antibody was raised using the middle region of AP2B1 corresponding to a region with amino acids DMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSI</p>

<p>eNOS antibody was raised in Mouse using a purified recombinant fragment of human eNOS expressed in E. coli as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MMP26 antibody, catalog no. 70R-9513</p>

<p>ABAT antibody was raised in Rabbit using Human ABAT as the immunogen</p>

<p>UCHL1 antibody was raised in rabbit using the C terminal of UCHL1 as the immunogen</p>

<p>FUT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCNQ5 antibody, catalog no. 70R-5180</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PPM1A antibody, catalog no. 70R-5788</p>

<p>MCSF antibody was raised in Rabbit using Human MCSF as the immunogen</p>

<p>Purified recombinant Human ARL2 protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Aak1 antibody, catalog no. 70R-9305</p>

<p>Rabbit anti=bovine IgG was raised in rabbit using ovine IgG F(ab')2 fragment as the immunogen.</p>

<p>KIF5C antibody was raised using the N terminal of KIF5C corresponding to a region with amino acids TVVIGQGKPYVFDRVLPPNTTQEQVYNACAKQIVKDVLEGYNGTIFAYGQ</p>

<p>AKR7A3 antibody was raised in Rabbit using Human AKR7A3 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal ITPK1 antibody</p>

<p>DAP3 antibody was raised in rabbit using the C terminal of DAP3 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DENND1A antibody, catalog no. 70R-3137</p>

<p>The CEA antibody is a monoclonal antibody used in Life Sciences. It has pro-angiogenic activity, meaning it promotes the growth of new blood vessels. This antibody can be used in various research applications, such as immunoassays and immunohistochemistry, to detect and quantify CEA (carcinoembryonic antigen) levels. CEA is a protein that is often elevated in certain types of cancer, particularly colorectal cancer. By targeting CEA, this antibody can help researchers better understand the role of CEA in cancer development and progression. Additionally, the CEA antibody has been shown to interact with other proteins, such as annexin A2 and epidermal growth factor, suggesting potential involvement in signaling pathways related to cell growth and proliferation. With its high specificity and sensitivity, the CEA antibody is a valuable tool for studying CEA-related processes and developing diagnostic tests for cancer detection.</p>

<p>Rabbit polyclonal p53 antibody (Ser15)</p>

<p>Rabbit polyclonal BMP6 antibody (FITC)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Ccbe1 antibody, catalog no. 70R-9189</p>

<p>Rabbit polyclonal NFKP p65 antibody (Thr435)</p>

<p>Rabbit polyclonal Beta Enolase antibody</p>

<p>The MEK2 antibody is a powerful tool used in life sciences research. It is an acidic antibody that has the ability to neutralize interferon, β-catenin, and TGF-beta proteins. This polyclonal antibody can be used in various applications, including Western blotting, immunohistochemistry, and immunofluorescence. It is commonly used in cancer research to study the effects of trastuzumab on tumor growth and metastasis. Additionally, this antibody can be used to detect the presence of specific proteins such as hemoglobin, alpha-fetoprotein, collagen, and TGF-β1. With its high specificity and sensitivity, the MEK2 antibody is an essential tool for researchers in the field of life sciences.</p>

<p>RWDD1 antibody was raised using the middle region of RWDD1 corresponding to a region with amino acids KKRMKEEEQAGKNKLSGKQLFETDHNLDTSDIQFLEDAGNNVEVDESLFQ</p>

<p>ASS1 antibody was raised in Rabbit using Human ASS1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PCK1 antibody, catalog no. 70R-1124</p>

<p>Rabbit polyclonal NR1I2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TGM1 antibody, catalog no. 70R-3477</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ST14 antibody, catalog no. 70R-3613</p>

<p>The MELK antibody is a highly specialized product in the field of Life Sciences. It is designed to target and neutralize the activity of Maternal Embryonic Leucine Zipper Kinase (MELK), a nuclear protein that plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in inhibiting the growth and proliferation of cancer cells.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AMD1 antibody, catalog no. 70R-2634</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GSTM5 antibody, catalog no. 70R-2852</p>

<p>The TIE1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target the TIE1 protein, which is activated by Helicobacter pylori infection. The antibody can be immobilized on an electrode or colloidal surface for various applications such as enzyme-linked immunosorbent assays (ELISA) or Western blotting. Additionally, the TIE1 antibody has been shown to have high affinity for collagen and can be used for studying collagen-related diseases. This antibody is reactive with human serum and can be used to detect and quantify TIE1 protein levels in biological samples. Its specificity and sensitivity make it an essential tool in understanding the role of TIE1 in various biological processes, including erythropoietin signaling and growth factor regulation.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EVX2 antibody, catalog no. 70R-8467</p>

<p>ARHGDIB antibody was raised in Rabbit using Human ARHGDIB as the immunogen</p>

<p>The PGC antibody is an anti-Mertk antibody that belongs to the class of antibodies. It is cytotoxic and has been shown to regulate E-cadherin expression. This antibody specifically targets nuclear markers and can be used in various life sciences applications. The PGC antibody also interacts with growth factors and plays a role in interferon signaling pathways. Additionally, it has been found to have multidrug resistance properties and can inhibit the activity of the circumsporozoite protein. With its ability to target tyrosine residues, the PGC antibody is a valuable tool for researchers working with monoclonal antibodies.</p>

<p>Rabbit polyclonal DGKK antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Slc12a5 antibody, catalog no. 70R-8588</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of 2810405K02Rik antibody, catalog no. 70R-9211</p>

<p>Rat IgG protein is a glycoprotein that belongs to the class of immunoglobulins. It plays a crucial role in the immune response by binding to specific antigens and promoting the clearance of pathogens. Rat IgG protein is widely used in Life Sciences research as an active agent in various applications, including immunostaining, flow cytometry, and Western blotting.</p>

<p>Rabbit polyclonal SSBP2 antibody</p>

<p>PPIE antibody was raised using a synthetic peptide corresponding to a region with amino acids KKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKP</p>

<p>VPS16 antibody was raised in rabbit using the N terminal of VPS16 as the immunogen</p>

<p>HNRPH3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DYQGRSTGEAFVQFASKEIAENALGKHKERIGHRYIEIFRSSRSEIKGFY</p>

<p>Affinity purified Rabbit polyclonal RAP2C antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C5orf36 antibody, catalog no. 70R-4264</p>

<p>Rabbit polyclonal PSMB7 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of THOC3 antibody, catalog no. 70R-4756</p>

<p>Rabbit polyclonal C56D2 antibody</p>

<p>SEK1 antibody is a polyclonal antibody that specifically targets the SEK1 protein kinase. This antibody has been shown to have neutralizing properties against IFN-gamma and antiphospholipid antibodies. It can be used in various life science applications, such as immunohistochemistry, to study the role of SEK1 in different biological processes. Additionally, this antibody may have potential therapeutic applications, particularly in the development of inhibitors for TNF-alpha and endotoxemia. Its ability to bind to collagen and tyrosine residues further enhances its versatility as a research tool.</p>

CHRNA7 antibody was raised in rabbit using the N terminal of CHRNA7 as the immunogen

<p>Rabbit anti-rat IgG (H+L) was raised in rabbit using rat IgG whole molecule as the immunogen.</p>

<p>Rabbit polyclonal NKTR antibody</p>

<p>KCTD9 antibody was raised using the middle region of KCTD9 corresponding to a region with amino acids AHANLCCANLERADLSGSVLDCANLQGVKMLCSNAEGASLKLCNFEDPSG</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RTKN antibody, catalog no. 70R-3077</p>

<p>XRRA1 antibody was raised using the N terminal of XRRA1 corresponding to a region with amino acids MAFSGIYKLDDGKPYLNNCFPARNLLRVPEEGQGHWLVVQKGNLKKKPKG</p>

<p>ZNF763 antibody was raised in rabbit using the N terminal of ZNF763 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF286 antibody, catalog no. 70R-8091</p>

<p>PFDN2 antibody was raised in rabbit using the middle region of PFDN2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RFPL2 antibody, catalog no. 70R-3277</p>

<p>Rabbit polyclonal GSK3 beta antibody</p>

<p>The Myc antibody is a highly effective polyclonal antibody that specifically targets the protein known as Myc. This antibody is widely used in the field of Life Sciences for various applications. Myc is a mitogen-activated protein that plays a crucial role in cell proliferation and differentiation processes. The Myc antibody can be used to detect and quantify the expression of Myc in different samples, such as tissues, cells, or biological fluids.</p>

<p>Purified Polyclonal EDG7 antibody</p>

<p>Rabbit polyclonal FAK antibody (Tyr397)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MFN2 antibody, catalog no. 70R-6460</p>

<p>Chicken IgG protein is a purified immunoglobulin that plays a crucial role in the field of life sciences. It is a growth factor that promotes cell proliferation and differentiation. This protein is available in its dimeric form, which enhances its stability and functionality. Chicken IgG protein is commonly used in research laboratories for various applications, including Western blotting, ELISA, and immunohistochemistry.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FOLR1 antibody, catalog no. 70R-7209</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HEXA antibody, catalog no. 70R-10239</p>

<p>RG9MTD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDLIYLTSDSPNILKELDESKAYVIGGLVDHNHHKGLTYKQASDYGINHA</p>

<p>ACCN4 antibody was raised using the N terminal of ACCN4 corresponding to a region with amino acids SPSSRGQMPIEIVCKIKFAEEDAKPKEKEAGDEQSLLGAVAPGAAPRDLA</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SDF4 antibody, catalog no. 70R-1850</p>

<p>FBXO28 antibody was raised using the middle region of FBXO28 corresponding to a region with amino acids KVQEQQKQLQDQDQKLLEQTQIIGEQNARLAELERKLREVMESAVGNSSG</p>

<p>The K2 antibody is a highly effective nucleotide molecule that targets alpha-synuclein, a protein associated with neurodegenerative diseases such as Parkinson's and Alzheimer's. This anti-her2 antibody-drug conjugate specifically binds to the HER2 receptor, which is overexpressed in certain types of cancer cells. It works by inhibiting the epidermal growth factor signaling pathway, preventing the growth and proliferation of cancer cells.</p>

<p>DNAI2 antibody was raised in Rabbit using Human DNAI2 as the immunogen</p>

<p>Purified Mouse IgG2a HRP conjugate</p>

<p>The FAK antibody is a monoclonal antibody that targets focal adhesion kinase (FAK). FAK is a protein involved in cell adhesion and migration, and its overexpression has been associated with various cancers. This antibody specifically binds to FAK, inhibiting its activity and preventing cancer cell growth and metastasis.</p>

<p>The GIT1 antibody is a monoclonal antibody that specifically targets and binds to GIT1 (G protein-coupled receptor kinase interacting protein 1). This antibody has been extensively studied and shown to have cytotoxic effects on various cancer cell lines. It has also been found to inhibit the interaction between GIT1 and other proteins such as alpha-fetoprotein and annexin A2, which are involved in tumor progression and metastasis.</p>

<p>GNB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRT</p>

<p>Rabbit polyclonal LCK antibody (Ser59)</p>

<p>Rabbit Polyclonal EGFR antibody (Tyr1092)</p>

<p>Purified recombinant Human SULT1C2 protein</p>

<p>PSPH antibody was raised using the middle region of PSPH corresponding to a region with amino acids PSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVA</p>

<p>Purified Polyclonal Cyclin L1 antibody</p>

<p>Goat anti-human lambda chain (biotin) was raised in goat using human l lambda chain as the immunogen.</p>

<p>GCLM antibody was raised in Rabbit using Human GCLM as the immunogen</p>

<p>TRAK1 antibody was raised using the middle region of TRAK1 corresponding to a region with amino acids ILETEAADLGNDERSKKPGTPGTPGSHDLETALRRLSLRRENYLSERRFF</p>

<p>The GPR132 antibody is a highly effective neutralizing agent that belongs to the class of monoclonal antibodies. It is specifically designed to target and bind to GPR132, a protein involved in various cellular processes. This antibody is available in both monoclonal and polyclonal forms, providing flexibility for different research needs.</p>

<p>PDXDC1 antibody was raised using the N terminal of PDXDC1 corresponding to a region with amino acids DEDEEPQSPRIQNIGEQGHMALLGHSLGAYISTLDKEKLRKLTTRILSDT</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C10orf38 antibody, catalog no. 70R-6823</p>

<p>Rabbit polyclonal NFKP p105/p50 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CKAP4 antibody, catalog no. 70R-6980</p>

<p>DDC antibody was raised in Rabbit using Human DDC as the immunogen</p>

<p>The N Cadherin antibody is a trifunctional antibody that has various applications in the field of Life Sciences. It can be used for research purposes, such as studying growth factors and their interactions with human serum. This antibody is commonly used in laboratory settings and can be used in experiments involving electrodes and other scientific equipment.</p>