Compuestos y reactivos bioquímicos

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NTNG2 antibody, catalog no. 70R-10047</p>

<p>Affinity purified Rabbit polyclonal SGTA antibody</p>

<p>Rabbit polyclonal RPA2 antibody (HRP)</p>

<p>Purified recombinant Human IFN alpha J1 protein</p>

<p>Rabbit polyclonal NR2F6 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PAM antibody, catalog no. 70R-7168</p>

<p>Canine Distemper Virus antibody is a powerful inhibitor that targets the fatty acid metabolism in infected cells. It has been shown to inhibit caspase-9, a key enzyme involved in cell death, and fibroin, a protein that supports the growth of the virus. This antibody is widely used in Life Sciences research to study the mechanisms of viral infection and develop new therapeutic strategies. Additionally, it has anti-VEGF properties, which can help inhibit the growth of blood vessels that support tumor growth. The monoclonal antibodies present in this product specifically target β-catenin, a protein involved in cell signaling pathways, as well as natriuretic hormone receptors and endothelial growth factor receptors. This comprehensive antibody provides researchers with a valuable tool for studying Canine Distemper Virus and its interactions with host cells.</p>

<p>Purified recombinant Human Cytokeratin 14 protein</p>

<p>Rabbit anti-mouse IgM (FITC) was raised in rabbit using murine IgM mu chain as the immunogen.</p>

<p>Rabbit polyclonal GABARAPL2 antibody (FITC)</p>

<p>CDK7 antibody was raised in rabbit using the C terminal of CDK7 as the immunogen</p>

<p>Purified recombinant Human CALB2 protein</p>

<p>Rabbit polyclonal PJA1 antibody</p>

<p>Affinity purified Rabbit polyclonal Tetraspan 1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC4A2 antibody, catalog no. 70R-6773</p>

<p>ANP32A antibody was raised using a synthetic peptide corresponding to a region with amino acids MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTI</p>

<p>Purified recombinant Human SAA4 protein</p>

<p>SNAPC1 antibody was raised in rabbit using the C terminal of SNAPC1 as the immunogen</p>

<p>Amylase antibody is a polyclonal antibody that specifically targets and binds to amylase, an enzyme responsible for the breakdown of starch into sugars. This antibody has been widely used in life sciences research to study the role of amylase in various biological processes.</p>

<p>Rabbit polyclonal MED23 antibody</p>

<p>DDX17 antibody was raised using a synthetic peptide corresponding to a region with amino acids TSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETDRAGYANGSGY</p>

<p>ST6GALNAC5 antibody was raised using the middle region of ST6GALNAC5 corresponding to a region with amino acids AFMITRHKMLQFDELFKQETGKDRKISNTWLSTGWFTMTIALELCDRINV</p>

<p>Goat anti-cat IgG (HRP) was raised in goat using feline IgG F(ab')2 fragment as the immunogen.</p>

<p>The MYB antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets the MYB protein, which plays a crucial role in various cellular processes. The MYB antibody has been extensively used in research to study the function and regulation of MYB in different contexts.</p>

<p>Purified Polyclonal PPP4R1L antibody</p>

<p>ADSL antibody was raised in Rabbit using Human ADSL as the immunogen</p>

<p>The PPM1B antibody is a monoclonal antibody that targets the phosphatase enzyme PPM1B. It has been extensively studied in the field of Life Sciences and has shown promising results in various applications. This antibody specifically recognizes and binds to PPM1B, inhibiting its activity and preventing its interaction with other molecules.</p>

<p>MTHFD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWE</p>

<p>Rabbit polyclonal CBF beta antibody</p>

<p>TARS antibody was raised using the N terminal of TARS corresponding to a region with amino acids PEYIYTRLEMYNILKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKT</p>

<p>Purified recombinant Human MAP1LC3B2 protein</p>

<p>DYNLL2 antibody was raised in Rabbit using Human DYNLL2 as the immunogen</p>

<p>The PCNA antibody is a glycosylated glycopeptide that is used to detect proliferating cell nuclear antigen (PCNA). It is commonly used in various research fields, including Life Sciences. The PCNA antibody can be used in applications such as immunohistochemistry, Western blotting, and ELISA. It specifically binds to PCNA, a protein that plays a crucial role in DNA replication and repair. The PCNA antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options based on their specific experimental needs. With its high specificity and sensitivity, the PCNA antibody is an essential tool for studying cellular processes involving PCNA.</p>

<p>MSSKEQKTPE GQAPEEIIMD QHEEIEAVEP EASAEQVDPR DEKIANLEAQ LAEAQTRERD GILRVKAEME NLRRRTELDI EKAHKFALEK FINELLPVID SLDRALEVAD KANPDMSAMV EGIELTLKSM LDVVRKFGVE VIAETNVPLD PNVHQAIAMV ESDDVAPGNV LGIMQKGYTL NGRTIRAAMV TVAKAKA</p>

<p>CAS antibody is a polyclonal antibody that is widely used in the field of Life Sciences. It is colloidal in nature and has been proven to be effective in detecting microvessel density. This antibody specifically targets tumor necrosis factor-alpha (TNF-α) and can be used for various applications, such as immunohistochemistry and Western blotting. CAS antibody also has the ability to bind to mimetic peptides and nuclear proteins, making it a versatile tool for research purposes. Additionally, this antibody can be used as a cross-linking agent in polymerase chain reactions (PCR) and has been shown to activate vascular endothelial growth factor-C (VEGF-C), which plays a crucial role in angiogenesis. With its high specificity and reliability, CAS antibody is an essential component for any laboratory studying cellular processes and protein interactions.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GJA9 antibody, catalog no. 70R-6100</p>

<p>Rabbit polyclonal GABARAPL2 antibody (HRP)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PTGDR antibody, catalog no. 70R-10286</p>

<p>Rabbit polyclonal GABRB1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GANAB antibody, catalog no. 70R-9357</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ELMO3 antibody, catalog no. 70R-6018</p>

<p>Recombinant Human CLEC1B protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SYP antibody, catalog no. 70R-6569</p>

<p>ATP2B4 antibody was raised using the middle region of ATP2B4 corresponding to a region with amino acids FAGEKFFDIDSGRKAPLHSPPSQHYTIVFNTFVLMQLFNEINSRKIHGEK</p>

<p>The GLUT3 antibody is a highly specific monoclonal antibody that targets mesothelin, a protein expressed in various cancer cells. This antibody has been extensively tested and validated for use in various assays, including immunohistochemistry and Western blotting. It can be used as a research tool to study the expression and function of mesothelin in different cell types and tissues.</p>

<p>Rabbit polyclonal Orosomucoid antibody</p>

<p>Purified Guinea Pig IgG HRP conjugate</p>

<p>Purified Polyclonal CD284 antibody</p>

<p>The beta catenin antibody is a polyclonal antibody that specifically targets β-catenin, a protein involved in various cellular processes. This antibody is widely used in life sciences research, particularly in studies involving transcription-polymerase chain reaction (PCR), collagen synthesis, and nuclear β-catenin localization. It has also been shown to interact with human p450 enzymes and play a role in chemical synthesis. Additionally, the beta catenin antibody has been found to modulate the activity of growth factors such as hepatocyte growth factor and inhibit cox-2 enzyme activity. Its specificity for cyp2a6 makes it an invaluable tool for studying liver microsomes and their functions. With its wide range of applications, this antibody is essential for researchers looking to explore the intricate mechanisms of cellular signaling pathways.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SEMA3D antibody, catalog no. 70R-6406</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of POLM antibody, catalog no. 70R-5619</p>

<p>DTD1 antibody was raised in Rabbit using Human DTD1 as the immunogen</p>

<p>CD152 antibody was raised in hamster using keat-killed Staphylococcus A bacteria coated with murine CTLA-4/human IgG1 fusion protein as the immunogen.</p>

<p>Rabbit anti-dog IgG (biotin) was raised in rabbit using canine IgG F(ab')2 fragment as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C20orf116 antibody, catalog no. 70R-7151</p>

<p>RUVBL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KIEEVKSTTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENAREACGV</p>

<p>Amyloid P antibody was raised in mouse using human serum amyloid P as the immunogen.</p>

<p>Goat anti-rabbit IgG (HRP) was raised in goat using rabbit IgG F(c) fragment as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of WBP2 antibody, catalog no. 70R-3623</p>

<p>The GAD67 antibody is a polyclonal antibody that targets the glutamate decarboxylase 67 (GAD67) enzyme. This enzyme plays a crucial role in the synthesis of the neurotransmitter gamma-aminobutyric acid (GABA). The GAD67 antibody can be used in various applications within the life sciences field, including immunohistochemistry, western blotting, and ELISA.</p>

<p>The FA7 antibody is a reactive monoclonal antibody that has antiestrogen properties. It is used in various applications, including natriuretic and cytotoxic assays. The FA7 antibody specifically targets the histamine H4 receptor and inhibits its activity, which can have therapeutic implications in antiestrogen therapy. Additionally, this antibody has been shown to modulate protein kinase activity and interact with other molecules such as fatty acids, cystatin, and interleukin-6. With its high specificity and effectiveness, the FA7 antibody is a valuable tool for research and diagnostic purposes.</p>

<p>Rabbit polyclonal eEF2K antibody (Ser359)</p>

<p>CD3 antibody (biotin) was raised in mouse using chicken CD3 as the immunoge.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LMAN1 antibody, catalog no. 70R-7295</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RDH16 antibody, catalog no. 70R-5493</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PI16 antibody, catalog no. 70R-6245</p>

<p>Rabbit polyclonal PGD antibody (FITC)</p>

<p>Goat anti-human IgG (biotin) was raised in goat using human IgG F(ab')2 fragment as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RXRA antibody, catalog no. 70R-1922</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Mettl4 antibody, catalog no. 70R-8799</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, which prevents transcription and replication, thus inhibiting bacterial growth. Through various metabolic transformations such as hydrolysis, oxidation, reduction, and conjugation, it undergoes conversion into its active form. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth. With its proven effectiveness and multiple mechanisms of action, the 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an excellent choice for combating tuberculosis infections.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TCEAL3 antibody, catalog no. 70R-8977</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NPTX2 antibody, catalog no. 70R-9388</p>

<p>Purified recombinant Human MAGEA5 Protein (His tag)</p>

<p>The ALPPL2 antibody is a polyclonal antibody used in the field of Life Sciences. It specifically targets ALPPL2, which is an enzyme involved in various cellular processes. This antibody has been extensively studied and proven to be effective in detecting ALPPL2 expression in different tissues and cell types.</p>

<p>IFN beta antibody was raised in mouse using human interferon beta as the immunogen.</p>

<p>Rabbit polyclonal Mammaglobin B antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC16A6 antibody, catalog no. 70R-6797</p>

<p>The NONO antibody is a highly specialized antibody used in Life Sciences research. It specifically targets the protein NONO, which plays a crucial role in various cellular processes. This polyclonal antibody is designed to recognize and bind to NONO with high specificity and affinity.</p>

<p>33-439 amino acids: MTVQGPPTSD DIFEREYKYG AHNYHPLPVA LERGKGIYLW DVEGRKYFDF LSSYSAVNQG HCHPKIVNAL KSQVDKLTLT SRAFYNNVLG EYEEYITKLF NYHKVLPMNT GVEAGETACK LARKWGYTVK GIQKYKAKIV FAAGNFWGRT LSAISSSTDP TSYDGFGPFM PGFDIIPYND LPALERALQD PNVAAFMVEP IQGEAGVVVP DPGYLMGVRE LCTRHQVLFI ADEIQTGLAR TGRWLAVDYE NVRPDIVLLG KALSGGLYPV SAVLCDDDIM LTIKPGEHGS TYGGNPLGCR VAIAALEVLE EENLAENADK LGIILRNELM KLPSDVVTAV RGKGLLNAIV IKETKDWDAW KVCLRLRDNG LLAKPTHGDI IRFAPPLVIK EDELRESIEI INKTILSF</p>

<p>Neu antibody was raised in mouse using tyrosine-phosphorylated synthetic peptide corresponding to amino acids 1242-1255 from the C-terminus of human c-erbB-2 protein. as the immunogen.</p>

<p>Furacilinum metabolite-OVA</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC13A3 antibody, catalog no. 70R-8505</p>

<p>CCRL1 antibody was raised in rabbit using the C terminal of CCRL1 as the immunogen</p>

<p>TIMP3 antibody was raised in rabbit using the N terminal of TIMP3 as the immunogen</p>

<p>Purified Polyclonal WFS1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HHIPL1 antibody, catalog no. 70R-9908</p>

<p>THAP6 antibody was raised in rabbit using the middle region of THAP6 as the immunogen</p>

<p>Recombinant human DERA protein</p>

<p>KRT14 antibody was raised in rabbit using the C terminal of KRT14 as the immunogen</p>

<p>RAB34 antibody was raised in rabbit using the C terminal of RAB34 as the immunogen</p>

<p>The TYK2 antibody is a highly effective antiviral agent that belongs to the class of monoclonal antibodies. It specifically targets the TYK2 protein, which plays a crucial role in various cellular processes such as β-catenin signaling and growth factor receptor activation. By binding to TYK2, this antibody inhibits its function and prevents viral replication and spread.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UBXN6 antibody, catalog no. 70R-9728</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of STIP1 antibody, catalog no. 70R-1289</p>

<p>Il5 antibody was raised in rabbit using the middle region of Il5 as the immunogen</p>

<p>RAS antibody was raised in mouse using recombinant human NRAS (1-186aa) purified from E. coli as the immunogen.</p>

<p>The HPRT antibody is a highly specialized monoclonal antibody that is used in various assays and experiments in the field of Life Sciences. It specifically targets the hypoxanthine-guanine phosphoribosyltransferase (HPRT) enzyme, which plays a crucial role in the metabolism of purine nucleotides.</p>

<p>The PLEKHF1 antibody is a highly specialized monoclonal antibody that serves as a serum marker for various medical conditions. This antibody specifically targets and binds to the PLEKHF1 antigen, which plays a crucial role in the regulation of interleukin production and immune response. By inhibiting the activity of PLEKHF1, this antibody can be used as a potential medicament in the treatment of autoimmune diseases, inflammatory disorders, and certain types of cancers.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C20orf116 antibody, catalog no. 70R-6275</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MYL4 antibody, catalog no. 70R-9372</p>

<p>Rabbit polyclonal CDH18 antibody</p>

<p>DCTN4 antibody was raised in Rabbit using Human DCTN4 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C8orf45 antibody, catalog no. 70R-4564</p>

<p>The G3BP1 antibody is a highly specialized monoclonal antibody that has been developed for use in Life Sciences research. It specifically targets and neutralizes the adeno-associated virus (AAV), which is commonly used as a vector in gene therapy applications. By inhibiting the activity of AAV, this antibody prevents viral replication and can be used to study the effects of AAV on cellular processes.</p>

<p>Region of IL4 protein corresponding to amino acids MHKCDITLQE IIKTLNSLTE QKTLCTELTV TDIFAASKNT TEKETFCRAA TVLRQFYSHH EKDTRCLGAT AQQFHRHKQL IRFLKRLDRN LWGLAGLNSC PVKEANQSTL ENFLERLKTI MREKYSKCSS.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PHB2 antibody, catalog no. 70R-2431</p>

<p>Purified recombinant Human CABP7 protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MIER3 antibody, catalog no. 70R-8433</p>

<p>Rabbit polyclonal RPS9 antibody (biotin)</p>

<p>Rabbit polyclonal PTPRE antibody</p>

<p>DPF2 antibody was raised in Rabbit using Human DPF2 as the immunogen</p>

<p>The GAP43 antibody is a polyclonal antibody that is widely used in life sciences research. It is commonly used to study the role of interferon in cellular processes. The antibody is produced by immunizing animals with GAP43, a protein found in the nervous system. It has high specificity and affinity for its target, making it an ideal tool for detecting and quantifying GAP43 levels in various biological samples.</p>

<p>Donkey anti-Sheep IgG (H + L) (HRP) was raised in donkey using purified Sheep IgG (H&amp;L) as the immunogen.</p>

<p>LTK antibody is a highly specialized test compound used in Life Sciences research. It is an antibody that specifically targets and binds to the LTK protein, which plays a crucial role in various cellular processes. This antibody is commonly used in assays to study the function and activity of LTK in different cell types, including pluripotent stem cells and isolated retinal cells.</p>

<p>Rabbit anti-rat IgG (Alk Phos) was raised in rabbit using rat IgG F(ab')2 fragment as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FHIT antibody, catalog no. 70R-4587</p>

<p>Recombinant human EFNB2 protein (His tag)</p>

<p>Desmin protein is a growth factor and cell antigen that plays a crucial role in endothelial growth. It is commonly used in the field of Life Sciences for research purposes. Desmin protein can be detected using monoclonal antibodies, which specifically bind to this protein. This recombinant protein has various applications, including the study of interleukin-6, lipase, phosphatase, fibrinogen, and triglyceride lipase. Additionally, Desmin protein is also used in the detection of autoantibodies and amyloid plaque formation. Its versatility makes it an essential tool for researchers in the field of Proteins and Antigens.</p>

<p>Affinity purified Rabbit polyclonal EVC2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OMP antibody, catalog no. 70R-2611</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF385 antibody, catalog no. 70R-7936</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C10orf96 antibody, catalog no. 70R-3327</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC22A23 antibody, catalog no. 70R-1742</p>

<p>HEV immunodominant regions of the Hepatitis E Virus protein.</p>

<p>The ADRB3 antibody is a powerful tool used in Life Sciences research. It specifically targets the adrenergic receptor beta 3 (ADRB3), which plays a crucial role in various physiological processes. This monoclonal antibody can be used to study the function and localization of ADRB3 in different tissues and cell types.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C3orf18 antibody, catalog no. 70R-6877</p>

<p>Rabbit polyclonal CDK1 antibody (Tyr15)</p>

<p>FTSJD1 antibody was raised using the middle region of FTSJD1 corresponding to a region with amino acids TKWFGQRNKYFKTYNERKMLEALSWKDKVAKGYFNSWAEEHGVYHPGQSS</p>

<p>Goat anti-Guinea Pig IgG (H + L) (HRP) was raised in goat using purified Guinea Pig IgG (H&amp;L) as the immunogen.</p>

<p>Purified recombinant S100A4 protein</p>

<p>Rabbit polyclonal HNRNPD antibody</p>

<p>Rabbit Polyclonal EGFR antibody (Tyr1110)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SETD4 antibody, catalog no. 70R-8041</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SDCBP antibody, catalog no. 70R-6235</p>

<p>KCNA7 antibody was raised using the C terminal of KCNA7 corresponding to a region with amino acids GEEAGMFSHVDMQPCGPLEGKANGGLVDGEVPELPPPLWAPPGKHLVTEV</p>

<p>Rabbit polyclonal CKMM antibody (FITC)</p>

<p>FKBP8 antibody was raised in Rabbit using Human FKBP8 as the immunogen</p>

<p>Recombinant human SNTA1 protein (His tag)</p>

<p>Rabbit polyclonal MPZ antibody (HRP)</p>

<p>Keratin K4 antibody was raised in Guinea Pig using synthetic peptide of human keratin K4 coupled to KLH as the immunogen.</p>

<p>NUDT6 antibody was raised in rabbit using the middle region of NUDT6 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AIM2 antibody, catalog no. 70R-8915</p>

<p>Purified recombinant PDGFRa protein</p>

<p>Region of FGF basic protein corresponding to amino acids PALPEDGGGA FPPGHFKDPK RLYCKNGGFF LRIHPDGRVD GVREKSDPHV KLQLQAEERG VVSIKGVCAN RYLAMKEDGR LLASKCVTEE CFFFERLESN NYNTYRSRKY SSWYVALKRT GQYKLGSKTG PGQKAILFLP MSAKS.</p>

<p>PSMD3 antibody was raised in rabbit using the middle region of PSMD3 as the immunogen</p>

<p>The Nanog antibody is a highly specific and potent tool used in Life Sciences research. It plays a crucial role as a growth factor and is involved in the regulation of pluripotency and self-renewal in embryonic stem cells. This antibody is widely used to study the activation products of Nanog, which are key protein biomarkers for various cellular processes.</p>

<p>Affinity purified Rabbit polyclonal ABH1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HNRNPR antibody, catalog no. 70R-4656</p>

<p>CCNH antibody was raised in Rabbit using Human CCNH as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ARFGAP1 antibody, catalog no. 70R-9476</p>

<p>Affinity purified Rabbit polyclonal CMAS antibody</p>

<p>EVX1 antibody was raised in rabbit using the N terminal of EVX1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC15A2 antibody, catalog no. 70R-6535</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PANX2 antibody, catalog no. 70R-1761</p>

<p>Rabbit polyclonal PDCD7 antibody</p>

<p>Region of PF4 protein corresponding to amino acids VTSAGPEESD GDLSCVCVKT ISSGIHLKHI TSLEVIKAGR HCAVPQLIAT LKNGRKICLD RQAPLYKKVI KKILES.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IFNA13 antibody, catalog no. 70R-10162</p>

<p>ATG2A antibody was raised using a synthetic peptide corresponding to a region with amino acids PRRGPAPGAADSQSWASCMTTSLQLAQECLRDGLPEPSEPPQPLEGLEMF</p>

<p>Rabbit polyclonal cJun antibody</p>

<p>C9ORF68 antibody was raised using the middle region of C9Orf68 corresponding to a region with amino acids CLDSSQFGKSSSSKQGDADFHGKASFATYQHSTSPGPLDQPLLRERFHPG</p>

<p>Purified recombinant Human ORAOV1 Protein (His tag)</p>

<p>RSU1 antibody was raised using the C terminal of RSU1 corresponding to a region with amino acids PIADQFQLGVSHVFEYIRSETYKYLYGRHMQANPEPPKKNNDKSKKISRK</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EPSTI1 antibody, catalog no. 70R-7096</p>

<p>Annexin A1 antibody was raised using the N terminal of ANXA1 corresponding to a region with amino acids WFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVD</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF259 antibody, catalog no. 70R-8256</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of F11 antibody, catalog no. 70R-10231</p>

<p>The BCAT1 antibody is a highly specialized antibody that plays a crucial role in various biological processes. It is commonly used in Life Sciences research and has proven to be effective in studying the receptor binding of certain substances. This antibody is particularly useful in the field of oncology, as it can help researchers understand the mechanisms behind cancer growth and potentially develop targeted therapies.</p>

<p>GABRG3 antibody was raised in rabbit using the N terminal of GABRG3 as the immunogen</p>

<p>PEG10 antibody was raised in Mouse using a purified recombinant fragment of PEG10(aa1-120) expressed in E. coli as the immunogen.</p>

<p>The GluR1 antibody is an activated antibody that targets glutamate receptors in the brain. It has been shown to inhibit the activity of insulin and butyrylcholinesterase, which are enzymes involved in glucose metabolism and neurotransmitter regulation. This antibody can be used in various research applications, such as immunohistochemistry and Western blotting, to study the expression and localization of GluR1 receptors. Additionally, it can be used in life sciences research to investigate the role of GluR1 receptors in neuronal signaling pathways and synaptic plasticity. The GluR1 antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs.</p>

<p>Affinity purified Rabbit polyclonal CAMKK1 antibody</p>

<p>The EPCR protein is a recombinant protein that falls under the category of Recombinant Proteins &amp; Antigens. It is widely used in the field of Life Sciences for various research purposes. This protein plays a crucial role in several biological processes and has been extensively studied in different contexts.</p>

<p>Rabbit polyclonal CARD11 antibody</p>

<p>VDAC1 antibody was raised using the C terminal of VDAC1 corresponding to a region with amino acids SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA</p>

<p>Rabbit Polyclonal NMDAR1 antibody (Ser897)</p>

<p>The Tau antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets and binds to the glucose transporter known as Tau. This antibody has been extensively studied and has shown great potential in various research applications.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SNAG1 antibody, catalog no. 70R-9638</p>

<p>ACSS1 antibody was raised in Rabbit using Human ACSS1 as the immunogen</p>

<p>F11 antibody was raised in rabbit using the C terminal of F11 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ENTPD7 antibody, catalog no. 70R-6301</p>