Compuestos y reactivos bioquímicos

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DDX47 antibody, catalog no. 70R-4750</p>

<p>TPD52L3 antibody was raised using the middle region of TPD52L3 corresponding to a region with amino acids GLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATLRS</p>

<p>S100A8 antibody was raised in rabbit using the middle region of S100A8 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LSM14A antibody, catalog no. 70R-4243</p>

<p>Rabbit polyclonal HADHB antibody (biotin)</p>

<p>Goat anti-rat IgM (biotin) was raised in goat using rat IgM mu chain as the immunogen.</p>

<p>SCAND2 antibody was raised in rabbit using the middle region of SCAND2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF205 antibody, catalog no. 20R-1197</p>

<p>MARCKS antibody was raised in rabbit using the C terminal of MARCKS as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OCIAD2 antibody, catalog no. 70R-3678</p>

<p>Rabbit polyclonal Major capsid protein L1 antibody</p>

<p>Rabbit polyclonal RPS18 antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GIMAP6 antibody, catalog no. 70R-9374</p>

<p>SPRR3 antibody was raised using the middle region of SPRR3 corresponding to a region with amino acids DQGFIKFPEPGAIKVPEQGYTKVPVPGYTKLPEPCPSTVTPGPAQQKTKQ</p>

<p>Rabbit polyclonal RPS25 antibody (FITC)</p>

<p>The MARCKS antibody is a highly specialized antibody that plays a crucial role in various biological processes. It is known to be involved in necrosis factor-related apoptosis-inducing pathways, as well as growth factor signaling. This antibody has been shown to interact with influenza hemagglutinin and regulate microvessel density.</p>

<p>MAGEA4 antibody was raised using the C terminal of MAGEA4 corresponding to a region with amino acids ENYLEYRQVPGSNPARYEFLWGPRALAETSYVKVLEHVVRVNARVRIAYP</p>

<p>Rabbit polyclonal TAX1BP3 antibody (HRP)</p>

<p>Cingulin antibody was raised in Guinea Pig using Full length GST-fusion protein of human cingulin as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ATG9A antibody, catalog no. 70R-6415</p>

<p>SND1/P100 antibody was raised in Mouse using a purified recombinant fragment of SND1 (aa361-485) expressed in E. coli as the immunogen.</p>

<p>Purified Polyclonal MRPL14 antibody</p>

<p>The Cox2 antibody is a growth factor that targets a specific cell antigen known as endothelial growth. It belongs to the category of polyclonal antibodies and is widely used in the field of Life Sciences. This antibody has been shown to have interactions with various proteins, including fibrinogen, lipoprotein lipase, and amyloid plaque. Additionally, it can inhibit the activity of lipase and phosphatase enzymes. The Cox2 antibody is available in both polyclonal and monoclonal forms, making it suitable for different research purposes. It is often used to detect autoantibodies or as a tool for studying triglyceride lipase activity. With its versatile applications, this antibody is an essential tool for researchers in various fields.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. Its potency has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their growth in culture.</p>

<p>Fresh tissue lysate prepared from rabbit liver</p>

<p>ATL2 antibody was raised in Rabbit using Human ATL2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EWSR1 antibody, catalog no. 70R-5013</p>

<p>Purified Horse IgG (Fc) FITC conjugate</p>

<p>HNRPL antibody was raised using the N terminal of HNRPL corresponding to a region with amino acids RRRSGAMVKMAAAGGGGGGGRYYGGGSEGGRAPKRLKTDNAGDQHGGGGG</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ALKBH2 antibody, catalog no. 70R-4415</p>

<p>Purified recombinant Human PPCS protein</p>

<p>DNAL4 antibody was raised in Rabbit using Human DNAL4 as the immunogen</p>

<p>Rabbit polyclonal PBX3 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PIGF antibody, catalog no. 70R-7111</p>

<p>CCL13 antibody was raised in rabbit using the middle region of CCL13 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NDP antibody, catalog no. 70R-6210</p>

<p>basic hair keratin K86 antibody was raised in Guinea Pig using synthetic peptide of human basic hair (trichocytic) keratin K86 coupled to KLH as the immunogen.</p>

<p>Rabbit polyclonal PIP5KL1 antibody</p>

<p>Region of Beta NGF protein corresponding to amino acids MSSTHPVFHM GEFSVCDSVS VWVGDKTTAT DIKGKEVTVL AEVNINNSVF RQYFFETKCR ASNPVESGCR GIDSKHWNSY CTTTHTFVKA LTTDEKQAAW RFIRIDTACV CVLSRKATRR G.</p>

<p>Rabbit polyclonal PCDHB15 antibody</p>

<p>CKM antibody was raised in Rabbit using Human CKM as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of WNT2B antibody, catalog no. 70R-2239</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SMC2 antibody, catalog no. 70R-2053</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RXRB antibody, catalog no. 70R-1919</p>

<p>Affinity purified Rabbit polyclonal Proteasome 20S alpha 3 antibody</p>

<p>ADK antibody was raised in mouse using recombinant human ADK (22-362aa) purified from E. coli</p>

<p>CX40.1 antibody was raised using the C terminal of CX40.1 corresponding to a region with amino acids QPRGRPHREAAQDPRGSGSEEQPSAAPSRLAAPPSCSSLQPPDPPASSSG</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TNNT1 antibody, catalog no. 70R-2585</p>

<p>Rabbit polyclonal ANP32B antibody</p>

<p>1-491 amino acids: MAVTQTAQAC DLVIFGAKGD LARRKLLPSL YQLEKAGQLN PDTRIIGVGR ADWDKAAYTK VVREALETFM KETIDEGLWD TLSARLDFCN LDVNDTAAFS RLGAMLDQKN RITINYFAMP PSTFGAICKG LGEAKLNAKP ARVVMEKPLG TSLATSQEIN DQVGEYFEEC QVYRIDHYLG KETVLNLLAL RFANSLFVNN WDNRTIDHVE ITVAEEVGIE GRWGYFDKAG QMRDMIQNHL LQILCMIAMS PPSDLSADSI RDEKVKVLKS LRRIDRSNVR EKTVRGQYTA GFAQGKKVPG YLEEEGANKS SNTETFVAIR VDIDNWRWAG VPFYLRTGKR LPTKCSEVVV YFKTPELNLF KESWQDLPQN KLTIRLQPDE GVDIQVLNKV PGLDHKHNLQ ITKLDLSYSE TFNQTHLADA YERLLLETMR GIQALFVRRD EVEEAWKWVD SITEAWAMDN DAPKPYQAGT WGPVASVAMI TRDGRSWNEF E</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C10orf33 antibody, catalog no. 70R-3261</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PEX5 antibody, catalog no. 70R-2342</p>

<p>The SOD antibody is a powerful tool in the field of Life Sciences. It is a cytotoxic and multidrug antibody that targets lipoprotein lipase, albumin, retinoid, and other important molecules. This polyclonal antibody has been extensively studied and shown to have high affinity for its target molecules. It has been used in various research applications, including the detection of interleukin-6, collagen, and other proteins in human serum. Additionally, this monoclonal antibody has been compared to adalimumab and shown to be highly effective in inhibiting the activity of TNF-α. Its versatility and reliability make it an essential tool for researchers in the field of Life Sciences.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FBP1 antibody, catalog no. 70R-1222</p>

<p>NCOR1 antibody was raised in Mouse using a purified recombinant fragment of NCOR1(aa1-192) expressed in E. coli as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CRP antibody, catalog no. 70R-4527</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PCK1 antibody, catalog no. 70R-2484</p>

<p>Purified Rabbit polyclonal MYB27 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PIWIL2 antibody, catalog no. 70R-2277</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Prr16 antibody, catalog no. 70R-9461</p>

<p>Mouse monoclonal Hepatitis C Virus antibody (core)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FBLN1 antibody, catalog no. 70R-5356</p>

<p>Streptavidin Poly-HRP20 Conjugate (diluted to 50ug/ml in stabilizer 85R-1028).</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EWSR1 antibody, catalog no. 70R-4833</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Sdc3 antibody, catalog no. 70R-8670</p>

<p>Rabbit polyclonal NFKP p65 antibody</p>

<p>ZNF527 antibody was raised in rabbit using the C terminal of ZNF527 as the immunogen</p>

<p>Rabbit polyclonal ADCK2 antibody</p>

<p>Rabbit Polyclonal PLCG2 antibody (Tyr1217)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRAFD1 antibody, catalog no. 70R-7948</p>

<p>The uPA antibody is a highly specialized protein kinase that plays a crucial role in various biological processes. This monoclonal antibody specifically targets the urokinase plasminogen activator (uPA), which is an important enzyme involved in tissue remodeling and cell migration. By binding to the uPA antigen, this antibody effectively inhibits its activity, preventing the degradation of extracellular matrix components and suppressing tumor invasion and metastasis.</p>

<p>Goat anti-rabbit IgG (H+L) (FITC) was raised in goat using rabbit IgG, whole molecule as the immunogen.</p>

<p>EIF3F antibody was raised in rabbit using the N terminal of EIF3F as the immunogen</p>

<p>Recombinant human PSMB3 protein (His tag)</p>

<p>Rabbit polyclonal Ephrin A4 antibody</p>

<p>Purified recombinant Human RANBP1 Protein (His tag)</p>

<p>AMZ2 antibody was raised in Rabbit using Human AMZ2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GOPC antibody, catalog no. 70R-3008</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ALG11 antibody, catalog no. 70R-6422</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LARP1 antibody, catalog no. 70R-4917</p>

<p>Mouse monoclonal Influenza A haemagglutinin H1 antibody</p>

<p>CRLS1 antibody was raised in Rabbit using Human CRLS1 as the immunogen</p>

<p>C22ORF25 antibody was raised using the N terminal Of C22Orf25 corresponding to a region with amino acids MCIIFFKFDPRPVSKNAYRLILAANRDEFYSRPSKLADFWGNNNEILSGL</p>

<p>APBB1 antibody was raised in Rabbit using Human APBB1 as the immunogen</p>

<p>Rabbit polyclonal CD97 alpha antibody</p>

<p>The CXCL9 antibody is a monoclonal antibody that specifically targets and binds to the chemokine CXCL9. This antibody is derived from bovine γ-globulin and has an antigen binding domain that recognizes the CXCL9 protein. It has been extensively studied in Life Sciences research for its role in immune responses and inflammation.</p>

<p>The DDC antibody is a powerful tool in the field of Life Sciences. It is an antibody that can be used for various applications, including research and diagnostic purposes. This antibody is highly specific and can recognize and bind to a target protein called DDC (dopa decarboxylase). DDC is an enzyme that plays a crucial role in the synthesis of important neurotransmitters like dopamine.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ST3GAL4 antibody, catalog no. 70R-7391</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

<p>Goat anti-rabbit IgG (FITC) was raised in goat using rabbit IgG F(ab')2 fragment as the immunogen.</p>

<p>Troponin I Type 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPLRRVRVSADAMLRALLGSKHKVSMDLRANLKSVKKEDTEKERPVEVGD</p>

<p>The Ku80 antibody is a monoclonal antibody that exhibits cell cytotoxicity and is used in various research applications within the Life Sciences field. It specifically targets the Ku80 protein, which is involved in DNA repair and plays a crucial role in maintaining genomic stability. This antibody can be used to study the function of Ku80 in different cellular processes, such as DNA damage response and repair mechanisms.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Gcom1 antibody, catalog no. 70R-3275</p>

<p>The PAX6 antibody is a growth factor that belongs to the class of monoclonal antibodies. It is designed to target and neutralize the PAX6 protein, which plays a crucial role in various biological processes. This antibody has been extensively studied and validated in Life Sciences research, making it a reliable tool for scientists and researchers. It can be used in experiments involving adipose tissue, nuclear signaling pathways, and other cellular processes where PAX6 is involved. The PAX6 antibody is also available as polyclonal antibodies for different applications, including the detection of chemokines, angptl3 inhibitors, and alpha-fetoprotein. With its high specificity and effectiveness, this antibody is an essential tool for studying PAX6-related mechanisms and exploring their potential therapeutic applications.</p>

<p>1-241 amino acids: GSTO1, also known as p28 or GSTTLp28, is a protein that localizes to the cytoplasm and contains both an N-terminal and a C-terminal GST domain. In mouse, the encoded protein acts as a small stress response protein, likely involved in cellular redox homeostasis. This protein has dehydroascorbate reductase activity and may function in the glutathione-ascorbate cycle as part of antioxidant metabolism. Recombinant human GSTO1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CHST13 antibody, catalog no. 70R-7172</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DRB1 antibody, catalog no. 70R-1352</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RBBP5 antibody, catalog no. 70R-8021</p>

<p>C17orf75 antibody was raised using the middle region of C17orf75 corresponding to a region with amino acids KLKAIQDTNNLKRFIRQAEMNHYALFKCYMFLKNCGSGDILLKIVKVEHE</p>

<p>ACAD9 antibody was raised in Rabbit using Human ACAD9 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CTTN antibody, catalog no. 70R-2725</p>

<p>Purified recombinant Human NANS protein</p>

<p>DMBT1 antibody was raised using the N terminal of DMBT1 corresponding to a region with amino acids SWSTPSPDTLPTITLPASTVGSESSLALRLVNGGDRCQGRVEVLYRGSWG</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GTSE1 antibody, catalog no. 70R-5496</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CA4 antibody, catalog no. 70R-1862</p>

<p>Rabbit polyclonal FOS antibody (Ser362)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of VASP antibody, catalog no. 70R-10268</p>

<p>WIPF2 antibody was raised using the middle region of WIPF2 corresponding to a region with amino acids AAPPPPPPVIRNGARDAPPPPPPYRMHGSEPPSRGKPPPPPSRTPAGPPP</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Onecut1 antibody, catalog no. 70R-7887</p>

<p>CPLX1 antibody was raised in Rabbit using Human CPLX1 as the immunogen</p>

<p>CHMP1A antibody was raised in Rabbit using Human CHMP1A as the immunogen</p>

<p>RSV antibody (FITC) was raised in goat using human RSV isolate as the immunogen.</p>

<p>CDC42EP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids HVGRGGDAFGDTSFLSRHGGGPPPEPRAPPAGAPRSPPPPAVPQSAAPSP</p>

<p>The Testosterone Antibody is a highly specialized monoclonal antibody that targets and inhibits the activity of testosterone, a key steroid hormone in the human body. This antibody is designed to specifically bind to testosterone molecules, neutralizing their effects and preventing them from interacting with their target receptors.</p>

<p>Purified recombinant Human HPGDS Protein (His tag)</p>

<p>Purified Polyclonal UBA7 antibody</p>

<p>The ANXA1 antibody is a highly specialized antibody that targets the adipocyte-specific antigen, Annexin A1 (ANXA1). This monoclonal antibody is widely used in Life Sciences research to study the role of ANXA1 in various biological processes. It specifically recognizes and binds to ANXA1, allowing researchers to investigate its function and regulation.</p>

<p>Annexin A5 antibody was raised using the N terminal of ANXA5 corresponding to a region with amino acids AYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVV</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SERPINA4 antibody, catalog no. 70R-9713</p>

<p>Rabbit polyclonal CNKR1 antibody</p>

<p>Purified Polyclonal PIK3R6 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LRRC42 antibody, catalog no. 70R-4131</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Cish antibody, catalog no. 70R-9203</p>

<p>Rabbit Polyclonal Paxillin antibody (Tyr118)</p>

<p>TBX15 antibody was raised in rabbit using the C terminal of TBX15 as the immunogen</p>

<p>FBLIM1 antibody was raised in Rabbit using Human FBLIM1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NR5A1 antibody, catalog no. 70R-1934</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LRFN3 antibody, catalog no. 70R-7159</p>

<p>1-142 amino acids: MSDSLVVCEV DPELTEKLRK FRFRKETDNA AIIMKVDKDR QMVVLEEEFQ NISPEELKME LPERQPRFVV YSYKYVHDDG RVSYPLCFIF SSPVGCKPEQ QMMYAGSKNR LVQTAELTKV FEIRTTDDLT EAWLQEKLSF FR</p>

<p>NET1 antibody was raised using the N terminal of NET1 corresponding to a region with amino acids RGDHRSPASAQKFSSRSTVPTPAKRRSSALWSEMLDITMKESLTTREIRR</p>

<p>KCNN1 antibody was raised using the C terminal of KCNN1 corresponding to a region with amino acids KIEQGKLNDQANTLTDLAKTQTVMYDLVSELHAQHEELEARLATLESRLD</p>

<p>The hnRNPF antibody is a polyclonal antibody that is used in various diagnostic applications. It is highly reactive and can be used to detect the presence of hnRNPF, a serine protease, in biological samples. This antibody has neutralizing properties and can be used to inhibit the activity of hnRNPF in experimental settings. It is commonly used as a diagnostic reagent in research laboratories and clinical settings.</p>

<p>The cSRC antibody is a highly specialized Polyclonal Antibody used in Life Sciences research. This antibody specifically targets the activated form of the cSRC protein, which plays a crucial role in cell signaling and regulation.</p>

<p>Purified Polyclonal RPL27A antibody</p>

<p>Purified recombinant NAT1 protein</p>

<p>GDE1 antibody was raised in Rabbit using Human GDE1 as the immunogen</p>

<p>ADD1 antibody was raised in Rabbit using Human ADD1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CCNDBP1 antibody, catalog no. 70R-2392</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SPDYA antibody, catalog no. 70R-2246</p>

<p>Rabbit polyclonal Kv2.1 antibody (Ser805)</p>

<p>ARHGAP15 antibody was raised using the middle region of ARHGAP15 corresponding to a region with amino acids VKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQ</p>

<p>Rabbit polyclonal NRIP2 antibody</p>

<p>Rabbit polyclonal Adiponectin antibody (biotin)</p>

<p>Affinity purified Rabbit polyclonal MORG1 antibody</p>

<p>Biotin antibody (FITC)</p>

<p>Purified recombinant Human NUDT9 protein</p>

<p>The P2RY1 antibody is a purinergic receptor reagent that belongs to the class of polyclonal antibodies. It is widely used in life sciences research as a valuable reagent for studying the purinergic signaling pathway. This antibody specifically targets the P2RY1 receptor, which is a G-protein coupled receptor involved in various cellular processes. By binding to the P2RY1 receptor, this antibody allows researchers to investigate its function and role in different biological systems. With its high specificity and sensitivity, the P2RY1 antibody is an essential tool for scientists looking to gain insights into purinergic signaling mechanisms.</p>

<p>FNTB antibody was raised in Rabbit using Human FNTB as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C1qtnf2 antibody, catalog no. 70R-9179</p>

<p>Protein kinase B, also known as Akt or RAC-alpha serine/threonine-protein kinase, is a serum- and glucocorticoid-regulated kinase with three closely related isoforms: Akt1, Akt2, and Akt3. While Akt1 and Akt3 are primarily expressed in the brain, Akt2 is most abundant in skeletal muscle and embryonic brown fat. These isoforms are key regulators in various physiological functions, including cell growth, proliferation, survival, angiogenesis, and metabolism, and Akt is also recognized as a proto-oncogene due to its role in cancer-related processes.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PPIL3 antibody, catalog no. 70R-2932</p>

<p>Rabbit polyclonal PSME2 antibody</p>

<p>Purified Polyclonal SYNE3 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SYT5 antibody, catalog no. 70R-9792</p>

<p>DGKA antibody was raised in Rabbit using Human DGKA as the immunogen</p>

<p>Purified Rabbit polyclonal SLC27A4 antibody</p>

<p>NHLH1 antibody was raised in rabbit using the middle region of NHLH1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ADORA1 antibody, catalog no. 70R-9942</p>

<p>Glucagon antibody was raised in rabbit using Porcine pancreatic glucagon/BSA as the immunogen.</p>

<p>TIGD3 antibody was raised using the N terminal of TIGD3 corresponding to a region with amino acids NKEKLLADWCSGTANRERKRKRESKYSGIDEALLCWYHIARAKAWDVTGP</p>

<p>Rabbit polyclonal RPL17 antibody (HRP)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GAMT antibody, catalog no. 70R-2584</p>

<p>CRABP2 antibody was raised in Rabbit using Human CRABP2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CHST7 antibody, catalog no. 70R-1906</p>

<p>FAM98A antibody was raised using the middle region of FAM98A corresponding to a region with amino acids YTGSGYQGGGYQQDNRYQDGGHHGDRGGGRGGRGGRGGRGGRAGQGGGWG</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of COBLL1 antibody, catalog no. 70R-3931</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PRODH2 antibody, catalog no. 70R-2398</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UGT1A4 antibody, catalog no. 70R-7257</p>

<p>PDIK1L antibody was raised using the middle region of PDIK1L corresponding to a region with amino acids FDPRSAYYLWFVMDFCDGGDMNEYLLSRKPNRKTNTSFMLQLSSALAFLH</p>

<p>FAM53A antibody was raised in rabbit using the C terminal of FAM53A as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TFF1 antibody, catalog no. 70R-6211</p>

<p>The Histamine H3 Receptor antibody is a high-quality monoclonal antibody that specifically targets the histamine H3 receptor. This antibody is widely used in life sciences research, including studies on human histamine receptors, egf-like growth factors, and cytotoxic assays. It has been proven to be highly effective in various applications, such as Western blotting, immunohistochemistry, and flow cytometry.</p>

<p>This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MGC4172 antibody, catalog no. 70R-6909</p>

<p>Rabbit polyclonal SmG antibody (FITC)</p>

<p>SGPP2 antibody was raised using the C terminal of SGPP2 corresponding to a region with amino acids SKPAESLPVIQNIPPLTTYMLVLGLTKFAVGIVLILLVRQLVQNLSLQVL</p>

<p>SIRPA antibody was raised in rabbit using the C terminal of SIRPA as the immunogen</p>

<p>Rabbit polyclonal DNAJ1 antibody (HRP)</p>

<p>ZMIZ2 antibody was raised in rabbit using the middle region of ZMIZ2 as the immunogen</p>

<p>Purified recombinant Human YARS2 Protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SULF2 antibody, catalog no. 70R-1881</p>