Compuestos y reactivos bioquímicos

<p>MBD1 antibody was raised using the C terminal of MBD1 corresponding to a region with amino acids  VKQEPPDPEEDKEENKDDSASKLAPEEEAGGAGTPVITEIFSLGGTRFRD</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Smpdl3a antibody, catalog no. 70R-9153</p>

<p>Physalaemin is a vasoactive intestinal peptide that belongs to the family of exocrine hormones. It is resistant to intracellular degradation and has been shown to be a potent inhibitor of vasopressin. Physalaemin has been shown to affect blood pressure by stimulating receptors in the brain that decrease blood pressure, as well as blocking naloxone-induced increases in blood pressure. Physalaemin also interacts with pancreatic cells, which may be due to its amino acid composition and ability to inhibit the release of caerulein from the pancreas. The effects on muscle cells are unknown, but it has been shown to have an inhibitory effect on the pancreas and intestine.</p>

<p>Rabbit serum against growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).</p>

<p>Hepatitis E virus (HEV) is a virus that infects the liver and causes hepatitis. Recombinant HEV ORF2 protein was produced by recombinant techniques in Escherichia coli. The recombinant HEV ORF2 protein has been shown to be immunogenic in mice, rabbits, and humans. Immunodominant epitopes were found at amino acid positions 448-456 and 468-480.</p>

<p>Insulin-like 5 (INSL5) is a protein that in humans is encoded by the INSL5 gene. It belongs to the insulin family of proteins and has been shown to have a role in various biological functions. INSL5 binds to the insulin receptor, which induces apoptosis in cancer cells by inhibiting cyclin-dependent kinase activity and inducing cell cycle arrest. The expression of INSL5 can be used as a diagnostic marker for cervical cancer and may also be used as a potential biomarker for cancer tissues.</p>

<p>The Anti NO Synthase II (77-105) (Rat) Serum is a research tool that can be used to activate, ligand or receptor. It can also be used to study cell biology as well as protein interactions. The Anti NO Synthase II (77-105) (Rat) Serum can inhibit ion channels and is a high purity antibody. This serum is made of peptides and proteins.</p>

<p>Human CRF ELISA (1ea) is a high-quality, competitively priced ELISA kit for the quantitative measurement of human CRF in rat serum. This assay has been designed for use in detecting the presence of CRF in biological fluids for research purposes. The kit contains all necessary components to perform the assay and detailed instructions are included.</p>

<p>Please enquire for more information about Amyloid β (1-42) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Kallidin is a peptide that has regulatory effects on tissue remodeling, inflammatory responses, and the growth of new blood vessels. It is found in a number of tissues, including extracellular matrix proteins, where it acts as a regulator. Kallidin has been shown to regulate kinins, which are hormones that are responsible for the regulation of inflammation. Kallidin also regulates collagen and fibrinogen production by stabilizing these proteins. This peptide also induces leukocyte recruitment and polymorphonuclear leukocytes (PMN) activity. Kallidin can stimulate growth factor production and may play an important role in the stabilization of matrix proteins such as fibronectin.</p>

<p>CD31 antibody (FITC) was raised in rat using murine leukocyte cell line 32D as the immunogen.</p>

<p>CD16 antibody (Spectral Red) was raised in rat using murine CD16/32 (CD16/Fc gamma II and CD32/Fc gamma III receptors)</p>

<p>Anti-human mesothelin monoclonal antibody.</p>

<p>CD25 antibody (PE) was raised in rat using IL-2-dependent BALB/c mouse helper T-cell clone HT-2 as the immunogen.</p>

<p>CD19 antibody (CY5) was raised in rat using murine CD19-expressing K562 human erythroleukemia cells as the immunogen.</p>

<p>Mouse monoclonal HSV1 + HSV2 antibody (FITC)</p>

<p>CD19 antibody (PE) was raised in mouse using CD19+ murine pre-B cell line as the immunogen.</p>

<p>CD4a antibody (PE) was raised in mouse using CD4a as the immunogen.</p>

<p>CD19 antibody (FITC) was raised in mouse using CD19+ murine pre-B cell line as the immunogen.</p>

<p>CD11a antibody (PE-CY7) was raised in rat using murine CD11a (LFA-1a) as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LOC728864 antibody, catalog no. 70R-6851</p>

<p>1-Benzyl-1,7-diazaspiro[4.5]decane dihydrochloride is a research tool for studying ion channels and ligand-receptor interactions. It is a potent inhibitor of the potassium channel Kv1.2, which is expressed in erythrocytes, and it has been used to study the role of these channels in regulating cell volume. 1-Benzyl-1,7-diazaspiro[4.5]decane dihydrochloride binds to the binding site of potassium channels that are activated by ATP and can act as an activator or antagonist depending on the protein expression level. This compound has also been used as a pharmacological probe for peptides, demonstrating its potential use as an antibody reagent.</p>

<p>Kaliotoxin (1-37) is a peptide that is used as a research tool in cell biology and pharmacology. It has been shown to activate the glycine receptor and inhibit the potassium channel. Kaliotoxin (1-37) binds to the glycine receptor and activates it, which leads to an influx of calcium ions into the cell. This increases intracellular levels of calcium ions, which then activate other processes including protein synthesis and cell division.</p>

<p>IL-17 Rat is a recombinant protein that is used as an immunological research tool. It is also used as a ligand to study the IL-17 receptor. IL-17 is a cytokine that activates cells in the immune system, such as T cells, B cells, and natural killer cells. This protein can be used in cell biology experiments to study cytokine signaling pathways and has been shown to inhibit ion channels. IL 17 rat can also be used in pharmacology studies to assess its effects on peptides and proteins within the body.</p>

<p>Pigment Yellow 120 is a pigment that belongs to the group of amide colorants. It has a yellow-orange hue and high thermal stability. Pigment Yellow 120 has been shown to be soluble in organic solvents, such as n-propyl ether, but insoluble in water. The molecular weight of pigment yellow 120 ranges from 800 to 1200 g/mol. Pigment Yellow 120 is produced by the polymerization reaction of monomers containing an amide group and a hydroxyl or basic group with a metal ion, such as copper or nickel, as a catalyst. This process also produces polycarboxylic acid groups and particles with diameters ranging from 0.1 micrometers to 2 micrometers.</p>

<p>CD44 antibody (Allophycocyanin) was raised in mouse using chicken CD44 as the immunogen.</p>

<p>CD16 antibody (PE) was raised in rat using murine CD16/32 (CD16/Fc gamma II and CD32/Fc gamma III receptors)</p>

<p>Streptococcus group A antibody (biotin) was raised in goat using group A Streptococci as the immunogen.</p>

<p>Anti-TIM-3 monoclonal antibody</p>

<p>CD117 antibody (PE) was raised in rat using murine CD117/c-Kit as the immunogen.</p>

<p>CD117 antibody (Spectral Red) was raised in rat using murine CD117/c-Kit as the immunogen.</p>

<p>CD21 antibody (biotin) was raised in mouse using porcine CD21 as the immunogen.</p>

<p>C2orf25 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSSGSDESHVAAAPPDICSRTVWPDETMGPFGPQDQRFQLPGNIGFDCHL</p>

<p>CD25 antibody (FITC) was raised in rat using IL-2-dependent BALB/c murine helper T-cell clone HT-2 as the immunogen.</p>

<p>CD45RB antibody was raised in rat using cloned mouse Th2 cell lines as the immunogen.</p>

<p>CD152 antibody (FITC) was raised in hamster using murine CD152/CTLA-4 as the immunogen.</p>

<p>CD117 antibody (biotin) was raised in rat using murine CD117/c-Kit as the immunogen.</p>

<p>CD19 antibody (biotin) was raised in rat using murine CD19-expressing K562 human erythroleukemia cells as the immunogen.</p>

<p>CD28 antibody (biotin) was raised in mouse using chicken CD28 as the immunogen.</p>

<p>CD31 antibody (PE-CY7) was raised in Rat using mouse leukocyte cell line 32D as the immunogen.</p>

<p>CD38 antibody (FITC) was raised in rat using CD38 as the immunogen.</p>

<p>CD40 antibody (FITC) was raised in rat using CD40 as the immunogen</p>

<p>CD154 antibody (Azide free) was raised in hamster using activated murine Th1 clone D1.6 as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TCL1A antibody, catalog no. 70R-2449</p>

<p>CD45R antibody (Allophycocyanin) was raised in rat using abelson murine leukemia virus-induced pre-B tumor cells as the immunogen.</p>

<p>CD3e antibody (Allophycocyanin) was raised in rat using CD3e as the immunogen.</p>

<p>CD38 antibody (Allophycocyanin) was raised in rat using CD38 as the immunogen.</p>

<p>CD23 antibody (PE-CY7) was raised in rat using CD23 low affinity IgE Fc receptor as the immunogen.</p>

<p>CD21 antibody (FITC) was raised in mouse using porcine CD21 as the immunogen.</p>

<p>Anti-Human TROP2 Monoclonal Antibody; 95%</p>

<p>Antibody-drug conjugate (ADC) of HER2-targeted trastuzumab with cytotoxic microtubule-inhibitory agent DM1 (derivative of maytansine).</p>

<p>Troponin T protein is a highly specific biomarker used in the diagnosis of cardiac conditions. It is a DNA aptamer that binds to troponin T, neutralizing its activity. This protein is found in human serum and its levels are elevated in cases of myocardial infarction or other cardiac events. Troponin T protein can be measured using immunoassays, such as monoclonal antibody-based assays or electrode immobilization techniques. It is commonly used in clinical settings to assess cardiac health and monitor patients undergoing treatment with medications like sorafenib. The use of Troponin T protein in Life Sciences research has significantly contributed to advancements in the understanding of cardiac diseases and the development of new diagnostic tools.</p>

<p>CD8a antibody (Azide free) was raised in rat using murine thymus or spleen as the immunogen.</p>

<p>CD25 antibody (Spectral Red) was raised in rat using IL-2-dependent BALB/c mouse helper T-cell clone HT-2 as the immunogen.</p>

<p>Ivuxolimab is an OX40 (also known as CD134; TNFRSF4) agonist monoclonal antibody.</p>

<p>CD16 antibody (biotin) was raised in rat using murine CD16/32 (CD16/Fc gamma II and CD32/Fc gamma III receptors)</p>

<p>CD45 antibody (Allophycocyanin) was raised in mouse using chicken CD45 as the immunogen.</p>

<p>CD49d antibody (Azide free) was raised in rat using the alpha-4 chain of the VLA-4 integrin heterodimer as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FCER1G antibody, catalog no. 70R-8649</p>

<p>CD49b antibody (PE) was raised in rat using RIL-2-propagated NK1.1+ cells from C57BL/6 mice as the immunogen.</p>

<p>CD106 antibody (Azide free) was raised in rat using murine CD106/VCAM-1 as the immunogen.</p>

<p>CD117 antibody (Allophycocyanin) was raised in rat using murine CD117/c-Kit as the immunogen.</p>

<p>CD25 antibody (Allophycocyanin) was raised in rat using IL-2-dependent BALB/c mouse helper T-cell clone HT-2 as the immunogen.</p>

<p>Anti-Human SLAMF7 Monoclonal Antibody</p>

<p>CD11b antibody (biotin) was raised in rat using C57BL/10 murine splenic T-cells and concanavalin A-activted C57BL/10 splenocytes as the immunogen.</p>

<p>CD30 antibody (PE) was raised in hamster using recombinant murine CD30 extracellular domain-mouse IgG1 fusion protein as the immunogen.</p>

<p>CD25 antibody (PE) was raised in rat using alpha chain IL-2 receptor as the immunogen.</p>

<p>CD20 antibody (PE-CY7) was raised in mouse using human CD20 as the immunogen.</p>

<p>CD45RB antibody (Spectral Red) was raised in rat using cloned murine Th2 cell lines as the immunogen.</p>

<p>CD3e antibody (FITC) was raised in hamster using H-2Kb-specific murine cytotoxic T lymphocyte as the immunogen.</p>

<p>CD45 antibody was raised in Rat using CD45/LCA as the immunogen.</p>

<p>Streptococcus group A antibody (FITC) was raised in goat using group A Streptococci as the immunogen.</p>

<p>CD45.2 antibody (Spectral Red) was raised in mouse using CD45.2 as the immunogen.</p>

<p>CD107b antibody (Allophycocyanin) was raised in rat using glycoproteins purified from BALB/c mouse embryo 3T3 cell line as the immunogen.</p>

<p>CD3 antibody (Allophycocyanin-CY7) was raised in mouse using the epsilon chain of CD3/T-cell antigen receptor complex as the immunogen.</p>

<p>CD45RB antibody (biotin) was raised in rat using cloned murine Th2 cell lines as the immunogen.</p>

<p>CD11b antibody (CY5) was raised in rat using C57BL/10 murine splenic T-cells and concanavalin A-activted C57BL/10 splenocytes as the immunogen.</p>

<p>CD3e antibody (FITC) was raised in mouse using porcine CD3e as the immunogen.</p>

<p>Catestatin is a peptide that belongs to the family of activators. Catestatin is an activator of potassium channels and can be used as a research tool. It has been shown to bind to the Kv1.2 receptor, which is expressed in human heart and skeletal muscle cells. This peptide also inhibits calcium-activated potassium channels, thereby blocking the transmission of nerve impulses. Catestatin has been shown to inhibit protein interactions with G protein-coupled receptors (GPCRs) and ion channels, thereby regulating cellular signaling pathways involved in cell growth and differentiation.</p>

<p>1-Myristoyl-sn-glycero-3-phosphocholine is a phospholipid that is used as a surfactant. It has been shown to increase the volume of human serum and pancreatic enzymes, which may be due to its matrix effect on tissue samples. 1-Myristoyl-sn-glycero-3-phosphocholine also binds with fatty acids and kynurenine in vitro. In this experiment, it was observed that 1-myristoyl-sn glycero 3 phosphatecholine increased the activity of kynurenine hydroxylase, an enzyme involved in the metabolism of tryptophan. This suggests that 1 myristoyl sn glycero 3 phosphocholine may be beneficial for patients with chronic fatigue syndrome or depression who are deficient in serotonin.</p>

<p>The MMP9 antibody is a polyclonal antibody that is widely used in the field of Life Sciences. It has been specifically designed to target and bind to the activated form of matrix metalloproteinase 9 (MMP9). This biomolecule plays a crucial role in various physiological and pathological processes, including cell-extracellular matrix interactions, tissue remodeling, and inflammation.</p>

<p>LY 225910 is a polymerase chain inhibitor that prevents the formation of new DNA. It has been shown to inhibit the activity of gamma-aminobutyric acid (GABA) in rat model systems and to reduce symptoms of epilepsy. LY 225910 has also been shown to inhibit chelerythrine, an inhibitor of protein kinases, and whole-cell recordings have demonstrated that LY 225910 inhibits cellular physiology by reducing fatty acid metabolism. This drug also binds to bradykinin B2 receptors and neurotrophic factors, such as endocannabinoids, growth factors, and glutamate.</p>

<p>Please enquire for more information about H-Asp-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Affinity purified Rabbit polyclonal LIMCH1 antibody</p>

<p>Fluorogenic probe used for the detection of reactive oxygen species</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DES antibody, catalog no. 70R-3807</p>

<p>Affinity purified Rabbit polyclonal ZNF211 antibody</p>

<p>ABCF1 antibody was raised in Rabbit using Human ABCF1 as the immunogen</p>

<p>Recombinant human IL-1alpha</p>

<p>Please enquire for more information about Human Albumin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ovarian Cancer Antigen (CA 125) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PLCB1 antibody, catalog no. 70R-5669</p>

<p>Region of TNF Receptor Type II protein corresponding to amino acids MAPEPGSTCR LREYYDQTAQ MCCSKCSPGQ HAKVFCTKTS DTVCDSCEDS TYTQLWNWVP ECLSCGSRCS SDQVETQACT REQNRICTCR PGWYCALSKQ EGCRLCAPLR KCRPGFGVAR PGTETSDVVC KPCAPGTFSN TTSSTDICRP HQICNVVAIP GNASMDAVCT STSP.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SERPINB13 antibody, catalog no. 70R-7068</p>

<p>The HIV1 gp120 protein is a growth factor and monoclonal antibody that plays a crucial role in the replication of the HIV virus. It binds to CD4 receptors on human cells, allowing the virus to enter and infect the host. The gp120 protein has been extensively studied in Life Sciences research, particularly in the development of vaccines and antiretroviral therapies. It can be used as a target for neutralizing antibodies and as a tool for studying the interaction between the virus and human serum. The recombinant form of gp120 exhibits high purity and photostability, making it ideal for various laboratory applications. Additionally, studies have shown that this protein interacts with other molecules such as glutamate, interferon, dopamine, tgf-beta, imatinib, and collagen, suggesting its involvement in multiple cellular processes.</p>

<p>CD11b antibody (FITC) was raised in rat using C57BL/10 murine splenic T-cells and concanavalin A-activted C57BL/10 splenocytes as the immunogen.</p>

<p>CD26 antibody (FITC) was raised in mouse using human T cell clone as the immunogen.</p>

<p>CD11a antibody (biotin) was raised in mouse using human CD11a (LFA-1a) as the immunogen.</p>

<p>CD49e antibody (PE) was raised in rat using C57BL/6 x A/J F1 murine mast cell line MC/9 as the immunogen.</p>

<p>CD3e antibody (FITC) was raised in mouse using porcine CD3e as the immunogen.</p>

<p>Influenza A antibody (FITC) was raised in mouse using Influenza A nucleoprotein as the immunogen.</p>

<p>CD66acde antibody was raised in mouse using human granulocytes as the immunogen.</p>

<p>CD11b antibody (PE) was raised in rat using C57BL/10 murine splenic T-cells and concanavalin A-activted C57BL/10 splenocytes as the immunogen.</p>

<p>CD11b antibody (PE was raised in rat using C57BL/10 murine splenic T-cells and concanavalin A-activted C57BL/10 splenocytes as the immunogen.</p>

<p>Anti-CD70</p>

<p>CD106 antibody (FITC) was raised in rat using murine CD106/VCAM-1 as the immunogen.</p>

<p>CD45R antibody (CY5) was raised in rat using abelson murine leukemia virus-induced pre-B tumor cells as the immunogen.</p>

<p>CD45.2 antibody (CY5) was raised in mouse using CD45.2 as the immunogen.</p>

<p>Purified native Human Luteinizing Hormone (Intact) (&gt; 98% pure)</p>

<p>CD24 antibody (Spectral Red) was raised in rat using murine heat stable antigen as the immunogen.</p>

<p>CD3e antibody (FITC) was raised in hamster using T cell receptor complexes derived from C6VL-BS thymoma cells as the immunogen.</p>

<p>CD44 antibody (FITC) was raised in mouse using chicken CD44 as the immunogen.</p>

<p>CD38 antibody (Spectral Red) was raised in rat using CD38 as the immunogen.</p>

<p>CD3 antibody (Allophycocyanin) was raised in mouse using the epsilon chain of CD3/T-cell antigen receptor complex as the immunogen.</p>

<p>CD19 antibody (Spectral Red) was raised in rat using murine CD19-expressing K562 human erythroleukemia cells as the immunogen.</p>

<p>CD3e antibody (Spectral Red) was raised in rat using CD3e as the immunogen.</p>

<p>CD40 antibody (Allophycocyanin) was raised in rat using CD40 as the immunogen</p>

<p>CD107a antibody (FITC) was raised in mouse using human CD107a/LAMP-1 as the immunogen.</p>

<p>CD41a antibody (biotin) was raised in ouse using human PBL as the immunogen.</p>

<p>CD45.1 antibody (PE-CY5.5) was raised in mouse using CD45.1 as the immunogen.</p>

<p>CD166 antibody (biotin) was raised in mouse using human thymic epithelial cells as the immunogen.</p>

<p>CD11b antibody (biotin) was raised in rat using peritoneal macrophages from C57 B1/6 x DBA/2 F1 hybrid mice as the immunogen.</p>

<p>Mirvetuximab is an antibody-drug conjugate (ADC), which is a targeted cancer therapy designed to deliver cytotoxic agents specifically to cancer cells. This ADC is derived from a monoclonal antibody that specifically binds to the folate receptor alpha (FRα), a protein overexpressed in certain types of cancer cells, including ovarian cancer. The mode of action involves the binding of Mirvetuximab to FRα on the cancer cell surface, followed by internalization of the complex. Once inside the cell, the cytotoxic drug is released, leading to cell death.Mirvetuximab is primarily utilized in the treatment of FRα-positive ovarian cancer, particularly in patients with platinum-resistant disease. By exploiting the differential expression of FRα, Mirvetuximab can deliver lethal doses of chemotherapy directly to the cancer cells, thereby minimizing systemic toxicity. This targeted approach enhances the therapeutic index of the treatment, improving efficacy while reducing adverse effects typically associated with conventional chemotherapy. Ongoing clinical trials are exploring its potential in other FRα-expressing malignancies, making it a pivotal component in the advancement of personalized cancer therapy.</p>

<p>Anti-Human CD27 Monoclonal Antibody</p>

<p>CD107b antibody (FITC) was raised in mouse using human CD107b/LAMP-2 as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of QPCTL antibody, catalog no. 70R-7419</p>

<p>Anti-Human CD25 Monoclonal Antibody</p>

<p>CD11a antibody (PE) was raised in mouse using human CD11a (LFA-1a) as the immunogen.</p>

<p>CD20 antibody (PE) was raised in mouse using human CD20 as the immunogen.</p>

<p>CD11a antibody (FITC) was raised in rat using murine CD11a (LFA-1a) as the immunogen.</p>

<p>CD117 antibody (PE) was raised in mouse using human MO7e tumor cells as the immunogen.</p>

<p>CD19 antibody (PE) was raised in mouse using human CD19 as the immunogen.</p>

<p>CD11b antibody (Allophycocyanin) was raised in rat using C57BL/10 murine splenic T cells and concanavalin A-activated C57BL/10 splenocytes as the immunogen.</p>

<p>CD26 antibody (biotin) was raised in mouse using human T cell clone as the immunogen.</p>

<p>CD22 antibody (Allophycocyanin) was raised in rat using CD22 as the immunogen.</p>

<p>CD117 antibody (Azide Free) was raised in rat using murine CD117/c-Kit as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AKT1S1 antibody, catalog no. 70R-3068</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SEPHS1 antibody, catalog no. 70R-1203</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RPS16 antibody, catalog no. 20R-1083</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF41 antibody, catalog no. 70R-8765</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FBXL2 antibody, catalog no. 70R-3091</p>

<p>The KLK1 antibody is a highly reactive polyclonal antibody used in Life Sciences research. It is specifically designed to target and bind to KLK1, also known as kallikrein 1, an enzyme involved in the antigen-antibody reaction. This antibody has been extensively tested and validated for its specificity and sensitivity in detecting KLK1 in various biological samples.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of H6PD antibody, catalog no. 70R-5347</p>

<p>The Ornithine decarboxylase antibody is a family kinase inhibitor that belongs to the group of antibodies. It is specifically designed to target and inhibit the activity of ornithine decarboxylase, an enzyme involved in polyamine synthesis. This antibody can be used in various research applications in the life sciences field, including studying the role of ornithine decarboxylase in cellular processes such as cell growth, proliferation, and differentiation.</p>

<p>PARP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ISRLPKGKHSVKGLGKTTPDPSANISLDGVDVPLGTGISSGVIDTSLLYN</p>

<p>Affinity purified Rabbit polyclonal Cytokeratin 34 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GLRX5 antibody, catalog no. 70R-3854</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PRKAB2 antibody, catalog no. 70R-3694</p>

<p>Affinity purified Rabbit polyclonal DCSIGN antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PDHB antibody, catalog no. 70R-3744</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of VDAC2 antibody, catalog no. 70R-5053</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ABCF3 antibody, catalog no. 70R-6278</p>

<p>ARFIP1 antibody was raised in Rabbit using Human ARFIP1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LPIN2 antibody, catalog no. 70R-10338</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C14orf21 antibody, catalog no. 70R-4983</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LYN antibody, catalog no. 70R-3701</p>