Compuestos y reactivos bioquímicos

<p>RFP2 antibody was raised in rabbit using the middle region of RFP2 as the immunogen</p>

<p>The SRR antibody is a highly effective neutralizing agent that targets glucose-6-phosphate, histidine, ketamine, and other biomolecules. This monoclonal antibody has been specifically designed to bind to activated cells and inhibit their growth. It has cytotoxic properties that make it an ideal candidate for use in life sciences research and biomaterials development. The SRR antibody has shown promising results in inhibiting the activity of growth factors such as sclerostin and epidermal growth factor. With its unique specificity and potent effects, this antibody is a valuable tool for scientists and researchers in various fields.</p>

<p>The beta Amyloid antibody is a highly effective and versatile product that offers a range of benefits in the field of Life Sciences. It is a Polyclonal Antibody that has been specifically designed to target and neutralize the beta-amyloid protein, which is associated with neurodegenerative diseases such as Alzheimer's.</p>

<p>Purified recombinant RGS10 protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NUP35 antibody, catalog no. 70R-2173</p>

<p>AP2B1 antibody was raised using the middle region of AP2B1 corresponding to a region with amino acids SETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKP</p>

<p>USP9Y antibody was raised in rabbit using the C terminal of USP9Y as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA1754L antibody, catalog no. 70R-6820</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NUP155 antibody, catalog no. 70R-2127</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GOLGB1 antibody, catalog no. 70R-6855</p>

<p>Naltrexone Conjugate for use in immunoassays</p>

<p>Purified recombinant Human HARS protein</p>

<p>RAPGEF3 antibody was raised using a synthetic peptide corresponding to a region with amino acids HGKVVLVLERASQGAGPSRPPTPGRNRYTVMSGTPEKILELLLEAMGPDS</p>

<p>The TrkA antibody is a polyclonal antibody that targets the growth factor receptor TrkA. It is commonly used in life sciences research and is valuable for studying various cellular processes. This antibody specifically binds to the amino-terminal region of TrkA and can be used for applications such as immunohistochemistry, Western blotting, and ELISA.</p>

<p>Region of Fractalkine protein corresponding to amino acids QHHGVTKCNI TCSKMTSKIP VALLIHYQQN QASCGKRAII LETRQHRLFC ADPKEQWVKD AMQHLDRQAA ALTRNG.</p>

<p>GABRG2 antibody was raised in Rabbit using Human GABRG2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of WBP2NL antibody, catalog no. 70R-2017</p>

<p>Recombinant human IL-10 protein (His tag)</p>

<p>RTN3 antibody was raised in Mouse using a purified recombinant fragment of RTN3 expressed in E. coli as the immunogen.</p>

<p>KLK-B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVS</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Rbm3 antibody, catalog no. 70R-8474</p>

<p>The CYP2A6 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and bind to the CYP2A6 protein complex, which plays a crucial role in metabolizing various substances in the human body. This antibody has been extensively tested and proven to effectively inhibit the enzymatic activity of CYP2A6.</p>

<p>Rabbit polyclonal NOMO1 antibody</p>

<p>CYP4A22 antibody was raised using the N terminal of CYP4A22 corresponding to a region with amino acids  MSVSVLSPSRRLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQ</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LBX2 antibody, catalog no. 70R-8694</p>

<p>NOL3 antibody was raised in rabbit using the middle region of NOL3 as the immunogen</p>

<p>Purified Polyclonal RAB38 antibody</p>

<p>DAZAP1 antibody was raised using the C terminal of DAZAP1 corresponding to a region with amino acids LAFPPPPSQAAPDMSKPPTAQPDFPYGQYAGYGQDLSGFGQGFSDPSQQP</p>

<p>TAF7L antibody was raised in rabbit using the middle region of TAF7L as the immunogen</p>

<p>The SOD1 antibody is a monoclonal antibody that specifically targets the erythropoietin receptor. It plays a crucial role in neutralizing superoxide, which is a harmful reactive oxygen species. This antibody can be used in various applications, including research and diagnostics.</p>

<p>Rabbit polyclonal PPP1R11 antibody (HRP)</p>

<p>Affinity purified Rabbit polyclonal GPR62 antibody</p>

<p>CHD9 antibody was raised in Rabbit using Human CHD9 as the immunogen</p>

<p>TM9SF1 antibody was raised using the middle region of TM9SF1 corresponding to a region with amino acids THTYSVRWSETSVERRSDRRRGDDGGFFPRTLEIHWLSIINSMVLVFLLV</p>

<p>PSG9 antibody was raised using the N terminal of PSG9 corresponding to a region with amino acids YSNASLLIQNVTRKDAGTYTLHIIKRGDETREEIRHFTFTLYLETPKPYI</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RUFY1 antibody, catalog no. 70R-2737</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UGT1A6 antibody, catalog no. 70R-7546</p>

<p>Region of MCP2 protein corresponding to amino acids  QPDSVSIPIT CCFNVINRKI PIQRLESYTR ITNIQCPKEA VIFKTKRGKE VCADPKERWV RDSMKHLDQI FQNLKP.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LOXL4 antibody, catalog no. 70R-10079</p>

<p>ZNF117 antibody was raised in rabbit using the middle region of ZNF117 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PCDHGA4 antibody, catalog no. 70R-6139</p>

<p>The p70S6 Kinase antibody is a highly effective Life Sciences product that serves as an essential tool for researchers and scientists. This antibody is designed to specifically target and bind to the p70S6 kinase, an enzyme involved in cell growth and proliferation. By inhibiting the activity of this kinase, the antibody can effectively regulate various cellular processes.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RELB antibody, catalog no. 20R-1128</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FBXL16 antibody, catalog no. 70R-3781</p>

<p>SOD1 antibody was raised using the N terminal of SOD1 corresponding to a region with amino acids MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHE</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FLJ14154 antibody, catalog no. 70R-2380</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ADARB1 antibody, catalog no. 70R-1550</p>

<p>Mouse monoclonal SDR9C7 antibody</p>

<p>RAG2 antibody was raised in Mouse using a purified recombinant fragment of human RAG2(350-527aa) expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal Cortactin antibody (Tyr421)</p>

<p>FBXO15 antibody was raised using the N terminal of FBXO15 corresponding to a region with amino acids QDKEAGYWKKEYITKQIASVKAALADILKPVNPYTGLPVKTKEALRIFGL</p>

<p>MPV17L antibody was raised using the N terminal of MPV17L corresponding to a region with amino acids MAGWWPALSRAARRHPWPTNVLLYGSLVSAGDALQQRLQGREANWRQTRR</p>

<p>Goat anti-mouse IgG/IgA/IgM (H+L) (Alk Phos) was raised in goat using murine IgG, IgA and IgM whole molecule as the immunogen.</p>

<p>ARHGAP26 antibody was raised in Rabbit using Human ARHGAP26 as the immunogen</p>

<p>The Nkx2.5 antibody is a powerful tool used in life sciences research. It is a polyclonal antibody that specifically targets the Nkx2.5 protein, which plays a crucial role in heart development and function. This antibody has been extensively tested and proven to be highly effective in various applications.</p>

<p>Purified recombinant Dengue VLP protein (Serotype 3) (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PNKP antibody, catalog no. 70R-4477</p>

<p>Rabbit polyclonal HSPC antibody (FITC)</p>

<p>This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.</p>

<p>Mouse monoclonal RDH14 antibody</p>

<p>The Src antibody is a highly specialized monoclonal antibody that plays a crucial role in Life Sciences research. It is specifically designed to target and detect autoantibodies against lipoprotein lipase, an enzyme involved in lipid metabolism. This antibody can be used for various applications, including immunohistochemistry, Western blotting, and enzyme-linked immunosorbent assays (ELISA). The Src antibody has been proven to effectively bind to lipoprotein lipase and other related proteins, such as phosphatases and growth factors. Its high specificity and affinity make it an invaluable tool for studying the function of lipoprotein lipase in different biological processes, including endothelial growth, adipose tissue metabolism, and triglyceride hydrolysis. Researchers can also utilize this antibody to investigate the role of lipoprotein lipase in conditions associated with dyslipidemia and metabolic disorders like obesity and cardiovascular diseases. With its exceptional performance and reliability, the Src antibody is a must-have for any laboratory</p>

<p>Sheep anti Pig IgG secondary antibody (Alk Phos)</p>

<p>The PLEKHG5 antibody is a highly specific antibody that targets nuclear β-catenin. It is widely used in the field of medicine as a medicament for various applications. This specific antibody has shown great efficacy in adipose tissue, where it exhibits cytotoxic effects on targeted cells. Its specificity and high affinity make it an ideal tool for research purposes such as transcription-polymerase chain reaction (PCR) and immunohistochemistry.</p>

<p>TNIP1 antibody was raised in rabbit using the C terminal of TNIP1 as the immunogen</p>

<p>AKR1C1 antibody was raised in rabbit using the N terminal of AKR1C1 as the immunogen</p>

<p>CD4 antibody (FITC) was raised in mouse using feline CD4 as the immunogen.</p>

<p>Rabbit polyclonal PHYHIP antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAM20A antibody, catalog no. 70R-7418</p>

<p>Rabbit polyclonal COX5A antibody (biotin)</p>

<p>CDC25B antibody was raised in Rabbit using Human CDC25B as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FEM1B antibody, catalog no. 70R-6027</p>

<p>The beta Galactosidase antibody is a powerful tool used in various research applications. This antibody is commonly used in fluorescent immunohistochemistry to detect the presence and localization of beta-Galactosidase in tissues and cells. It can also be used for the detection of beta-Galactosidase activity in nuclear extracts.</p>

<p>Purified Polyclonal FXR2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ALDH4A1 antibody, catalog no. 70R-1106</p>

<p>ARHGAP15 antibody was raised in Rabbit using Human ARHGAP15 as the immunogen</p>

<p>GINS2 antibody was raised in Rabbit using Human GINS2 as the immunogen</p>

<p>Goat anti-monkey IgM was raised in goat using monkey IgM as the immunogen.</p>

<p>Affinity purified Rabbit polyclonal FIG4 antibody</p>

<p>Affinity purified Mouse polyclonal GBP1 antibody</p>

<p>CD31 antibody (Azide Free) was raised in rat using murine leukocyte cell line 32d as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC39A8 antibody, catalog no. 70R-6510</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>Complement C1q antibody was raised in mouse using human complement C1q as the immunogen.</p>

<p>Rabbit polyclonal CD2 Tail-binding antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PNMA2 antibody, catalog no. 70R-9173</p>

<p>Rabbit Polyclonal Cofilin 2 antibody (Tyr88)</p>

<p>Affinity purified Rabbit polyclonal Phospholipase A2 XIIA antibody</p>

<p>HCN3 antibody was raised in Rabbit using Human HCN3 as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, hindering transcription and replication processes, thus inhibiting bacterial growth. Extensive studies have been conducted using the patch-clamp technique on human erythrocytes to confirm its efficacy. The metabolization of this drug involves various metabolic transformations, such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and impedes cell growth in culture.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PCDHGC3 antibody, catalog no. 70R-6138</p>

<p>Affinity purified Rabbit polyclonal C20orf11 antibody</p>

<p>Amphiphysin antibody was raised using the N terminal of AMPH corresponding to a region with amino acids ADIKTGIFAKNVQKRLNRAQEKVLQKLGKADETKDEQFEEYVQNFKRQEA</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AGT antibody, catalog no. 70R-6214</p>

<p>NOVA1 antibody was raised using the middle region of NOVA1 corresponding to a region with amino acids TNGYFGAASPLAASAILGTEKSTDGSKDVVEIAVPENLVGAILGKGGKTL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CXCR4 antibody, catalog no. 70R-7849</p>

<p>GSG1 antibody was raised using the N terminal of GSG1 corresponding to a region with amino acids NYWFVGTQKVPKPLCEKGLAAKCFDMPVSLDGDTNTSTQEVVQYNWETGD</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>Ubxn2a antibody was raised in rabbit using the middle region of Ubxn2a as the immunogen</p>

<p>The 4EBP1 antibody is a growth factor monoclonal antibody that specifically targets the 4EBP1 protein. It is widely used in Life Sciences research to study various cellular processes, including cell proliferation, apoptosis, and protein synthesis. The 4EBP1 antibody has been shown to be highly specific and sensitive in detecting the expression of 4EBP1 in different cell types, such as MCF-7 breast cancer cells. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and flow cytometry. It is produced by a hybridoma cell line and purified using streptavidin-coated beads for maximum specificity and minimal background noise. The 4EBP1 antibody is compatible with various sample types, including human serum and tissues. It can also be used for electrode-based assays or intraocular immobilization experiments due to its stability and high affinity for its target protein.</p>

<p>OVA conjugated Estrone Hapten</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NR1H4 antibody, catalog no. 70R-1941</p>

<p>acidic hair keratin K32 antibody was raised in Guinea Pig using synthetic peptide of human hair (trichocytic) keratin K32 coupled to KLH as the immunogen.</p>

<p>Rabbit Polyclonal Histone H3.1 antibody (Ser10)</p>

<p>Rabbit polyclonal 5HT1F antibody</p>

<p>Rabbit polyclonal Histone H2Ax antibody (biotin)</p>

<p>Purified recombinant PPME1 protein</p>

<p>Gyg antibody was raised in rabbit using the C terminal of Gyg as the immunogen</p>

<p>Dgat2 antibody was raised in rabbit using the C terminal of Dgat2 as the immunogen</p>

<p>Purified recombinant POU2AF1 protein</p>

<p>The BRCA1 antibody is a powerful tool used in Life Sciences research. It is commonly used in immunoassays to detect and quantify the expression of BRCA1 protein. This antibody specifically targets BRCA1, a tumor suppressor gene that plays a crucial role in DNA repair and cell growth regulation. By binding to BRCA1, the antibody allows for the visualization and measurement of this important growth factor.</p>

<p>EIF4E2 antibody was raised in Rabbit using Human EIF4E2 as the immunogen</p>

<p>CPSF4 antibody was raised in Rabbit using Human CPSF4 as the immunogen</p>

<p>Purified Rat IgG (Fab) HRP conjugate</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NIT1 antibody, catalog no. 70R-3084</p>

<p>CYP26B1 antibody was raised using the N terminal of CYP26B1 corresponding to a region with amino acids LRWAATRDKSCKLPIPKGSMGFPLIGETGHWLLQGSGFQSSRREKYGNVF</p>

<p>Affinity purified Rabbit polyclonal Galanin Receptor 2 antibody</p>

<p>The ABI1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to the ABI1 protein, which plays a crucial role in various cellular processes. This antibody has been extensively tested and validated for its efficacy and specificity.</p>

<p>Rabbit polyclonal OPLAH antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FLJ20628 antibody, catalog no. 70R-2194</p>

<p>Ticarcillin monosodium monohydrate (USP grade powder) chemical reference substance</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PCSK2 antibody, catalog no. 70R-9811</p>

<p>The PRKCZ antibody is a high-flux affinity binder that specifically targets the antigen PRKCZ. It is a monoclonal antibody used in Life Sciences research for various applications, including chemotherapy and studying tumor-related macrophages. Additionally, this antibody can be used to detect and quantify glyceraldehyde-3-phosphate dehydrogenase (GAPDH) levels in cells and tissues. GAPDH is an essential enzyme involved in glycolysis and has been implicated in various cellular processes. The PRKCZ antibody is also valuable in the development of antiviral therapies and the detection of autoantibodies. With its high specificity and sensitivity, this antibody is a powerful tool for researchers in the field of Life Sciences.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC40A1 antibody, catalog no. 70R-8584</p>

<p>ARFIP1 antibody was raised in rabbit using the C terminal of ARFIP1 as the immunogen</p>

<p>RSV antibody was raised in goat using human RSV isolate as the immunogen.</p>

<p>The Pyk2 antibody is a highly specialized monoclonal antibody that targets the protein tyrosine kinase 2 (Pyk2). This antibody is widely used in research and diagnostic applications to study the role of Pyk2 in various cellular processes.</p>

<p>Rabbit polyclonal SOX12 antibody</p>

<p>CIB3 antibody was raised using the N terminal of CIB3 corresponding to a region with amino acids QDLAPQLVPLDYTTCPDVKVPYELIGSMPELKDNPFRQRIAQVFSEDGDG</p>

<p>Goat anti-mouse IgM (HRP) (mu chain specific) was raised in goat using murine IgM, Mu-chain as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Arpp21 antibody, catalog no. 70R-8517</p>

<p>1-224 amino acids: MGSSHHHHHH SSGLVPRGSH MSPILGYWKI KGLVQPTRLL LEYLEEKYEE HLYERDEGDK WRNKKFELGL EFPNLPYYID GDVKLTQSMA IIRYIADKHN MLGGCPKERA EISMLEGAVL DIRYGVSRIA YSKDFETLKV DFLSKLPEML KMFEDRLCHK TYLNGDHVTH PDFMLYDALD VVLYMDPMCL DAFPKLVCFK KRIEAIPQID KYLKSSKYIA WPLQGWQATF GGGDHPPKSD LVPR</p>

<p>Rabbit Polyclonal Chk2 antibody (Ser516)</p>

<p>LARP7 antibody was raised using the C terminal of LARP7 corresponding to a region with amino acids HCWKLEILSGDHEQRYWQKILVDRQAKLNQPREKKRGTEKLITKAEKIRL</p>

<p>MLXIP antibody was raised in Rabbit using Human MLXIP as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SSX7 antibody, catalog no. 70R-9113</p>

<p>The SMAD antibody is a highly specific monoclonal antibody that targets the SMAD protein, an important regulator of cellular processes. This antibody is widely used in Life Sciences research to study various cellular pathways and signaling cascades. It specifically recognizes the nuclear localization of SMAD and inhibits its function by blocking its interaction with other proteins. The SMAD antibody has been extensively validated for use in immunohistochemistry, western blotting, and other molecular biology techniques. It is a valuable tool for researchers studying cell antigens, glycosylation, exocytosis, and phosphatase activity. Whether you are investigating the role of SMAD in cancer development or studying the effects of interleukin-6 on cellular processes, the SMAD antibody is an essential component of your research toolkit. Choose this high-quality polyclonal antibody to ensure accurate and reliable results in your experiments.</p>

<p>DHDH antibody was raised using a synthetic peptide corresponding to a region with amino acids PCWCPTELVVKGEHKEFPLPPVPKDCNFDNGAGMSYEAKHVWECLRKGMK</p>

<p>ISCU antibody was raised in Rabbit using Human ISCU as the immunogen</p>

<p>GSTZ1 antibody was raised in Rabbit using Human GSTZ1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ISL2 antibody, catalog no. 20R-1151</p>

<p>The Aggrecan antibody is a highly effective inhibitor that belongs to the class of Monoclonal Antibodies. It targets and neutralizes Vascular Endothelial Growth Factor (VEGF), a growth factor involved in angiogenesis. By blocking VEGF, the Aggrecan antibody prevents the formation of new blood vessels, inhibiting tumor growth and metastasis. Additionally, this antibody has been shown to inhibit the production of superoxide, a reactive oxygen species that can cause oxidative damage to cells. The Aggrecan antibody also binds to insulin and insulin-like growth factor binding proteins, regulating their activity and promoting cellular responses such as cell proliferation and survival. With its wide range of applications in Life Sciences research, this antibody is an essential tool for studying various biological processes and developing therapeutic strategies.</p>

<p>Affinity purified Rabbit polyclonal SHKBP1 antibody</p>

<p>Purified recombinant Rotavirus VP6 protein (His tag)</p>

<p>RORA antibody was raised using the N terminal of RORA corresponding to a region with amino acids TPTPAGEGARRDELFGILQILHQCILSSGDAFVLTGVCCSWRQNGKPPYS</p>

<p>Donkey anti-goat IgG (H + L) (biotin) was raised in donkey using goat IgG (H &amp; L) as the immunogen.</p>

<p>The Ku80 antibody is a serotonergic antibody that targets the c-myc protein. It is widely used in the Life Sciences field for various applications. This polyclonal antibody is derived from human serum and specifically recognizes the fatty acid-activated nuclear alpha-fetoprotein hormone peptide. The Ku80 antibody can be used in experiments involving immunohistochemistry, Western blotting, and ELISA assays. Its high specificity and affinity make it an ideal tool for detecting and quantifying the target antigen. Whether you're conducting research or developing diagnostic tests, the Ku80 antibody is a valuable asset in your laboratory.</p>

<p>LRP antibody (515 kDa) was raised in mouse using human LRP/a2MR as the immunogen.</p>

<p>DOK7 antibody was raised in rabbit using the C terminal of DOK7 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC44A3 antibody, catalog no. 70R-6722</p>

<p>Rabbit polyclonal RXFP2 antibody</p>

<p>Mouse anti-Enterobacteriaciae Antibody</p>

<p>DPYSL3 antibody was raised in Rabbit using Human DPYSL3 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PLOD2 antibody, catalog no. 70R-5438</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FSTL5 antibody, catalog no. 70R-1991</p>

<p>Rabbit polyclonal OSBPL2 antibody</p>

<p>Purified Polyclonal Cystatin B antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TUBA8 antibody, catalog no. 70R-9492</p>

<p>Purified Polyclonal CHRNA3 antibody</p>

<p>Rabbit polyclonal FA10 antibody</p>

<p>Region of OTOR protein corresponding to amino acids MVHGIFMDRL ASKKLCADDE CVYTISLASA QEDYNAPDCR FINVKKGQQI YVYSKLVKEN GAGEFWAGS VYGDGQDEMG VVGYFPRNLV KEQRVYQEAT KEVPTTDIDF FCE.</p>

<p>Purified Polyclonal CD156c antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PRSS8 antibody, catalog no. 70R-4537</p>

<p>Shpk antibody was raised in rabbit using the middle region of Shpk as the immunogen</p>

<p>Mrps33 antibody was raised in rabbit using the middle region of Mrps33 as the immunogen</p>

<p>The Opioid Receptor antibody is a highly specialized antibody used in Life Sciences research. It is available in both polyclonal and monoclonal forms. This antibody specifically targets the opioid receptor protein, which plays a crucial role in pain modulation and addiction pathways.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MEGF11 antibody, catalog no. 70R-8850</p>

<p>RIPK2 antibody was raised in rabbit using the middle region of RIPK2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PARVB antibody, catalog no. 70R-6053</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C20orf111 antibody, catalog no. 70R-4348</p>

<p>Rabbit polyclonal Cystatin B antibody (HRP)</p>

<p>Purified recombinant Human RAB1B protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RNMT antibody, catalog no. 70R-4827</p>

<p>Affinity purified Rabbit polyclonal Syntrophin alpha 1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GSDML antibody, catalog no. 70R-2356</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SIGLEC12 antibody, catalog no. 70R-6148</p>

<p>EME1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MALKKSSPSLDSGDSDSEELPTFAFLKKEPSSTKRRQPEREEKIVVVDIS</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CARD17 antibody, catalog no. 70R-10271</p>

<p>The Peanut Protein Antibody is a highly versatile and effective product with a wide range of characteristics and applications. It possesses antiviral properties and acts as a growth factor, making it an essential tool in various research fields. This antibody has been extensively studied for its ability to combat infections caused by Mycoplasma genitalium and its potential for inhibiting hemolysis.</p>

<p>SMN1 antibody was raised using the N terminal of SMN1 corresponding to a region with amino acids KAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKV</p>