Compuestos y reactivos bioquímicos
Los bioquímicos y reactivos son sustancias fundamentales para la investigación y el desarrollo en campos como la biotecnología, la biología molecular, la farmacología y la medicina. Estos productos son esenciales para una variedad de aplicaciones, incluyendo la síntesis de compuestos, el análisis de muestras biológicas, la investigación de procesos metabólicos y la producción de medicamentos. En CymitQuimica, ofrecemos una amplia selección de bioquímicos y reactivos de alta calidad y pureza, adecuados para diversas necesidades científicas e industriales. Nuestro catálogo incluye enzimas, anticuerpos, ácidos nucleicos, aminoácidos, y muchos otros productos, todos diseñados para apoyar a los investigadores y profesionales en sus proyectos de investigación y desarrollo, asegurando resultados confiables y reproducibles.
Subcategorías de "Compuestos y reactivos bioquímicos"
- Biomoléculas(99.127 productos)
- Por objetivo biológico(99.160 productos)
- Según efectos farmacológicos(6.787 productos)
- Crioconservantes(21 productos)
- Desinfectantes y compuestos relacionados(28 productos)
- Hormonas(346 productos)
- Biología Vegetal(6.742 productos)
- Metabolitos secundarios(14.222 productos)
Se han encontrado 130581 productos de "Compuestos y reactivos bioquímicos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
PACAP-38, amide, frog
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C204H333N63O53SPeso molecular:4,548.38 g/mol[D-Cys6,Asn7,D-Ala11,Cys14]-Bombesin (6-14)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C44H64N14O10S2Peso molecular:1,013.22 g/molMARCKS Protein (151-175)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C147H243N41O31Peso molecular:3,080.83 g/mol[D-Trp2,7,9]-Substance P
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C80H109N21O13SPeso molecular:1,604.96 g/molPrepro-Nerve Growth Factor (99-115) (mouse)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C89H139N27O26Peso molecular:2,003.25 g/molBPDEtide [RKISASEFDRPLR]
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C68H115N23O20Peso molecular:1,574.82 g/molBradykinin-Like Neuropeptide (3-11) (Aplysia californica)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C42H77N21O12Peso molecular:1,068.22 g/molDAP10 Signaling Fragment
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C74H118N22O24SPeso molecular:1,731.96 g/molGLP-2 (1-33) (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C165H254N44O55SPeso molecular:3,766.1 g/molPKA Regulatory Subunit II Substrate
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C92H151N28O32PPeso molecular:2,192.39 g/molFmoc-Mating Factor a
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C97H125N20O19SPeso molecular:1,907.26 g/mol[Des-Leu26,Cys(Acm)20,31]-EGF (20-31)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C57H87N15O22S3Peso molecular:1,430.61 g/molC-terminal Proghrelin Isoform Peptide, mouse
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C50H86N22O17Peso molecular:1,267.38 g/molEcdysis-Triggering Hormone (Manduca sexta)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C127H206N36O38S3Peso molecular:2,941.45 g/molBiotin-Bombesin
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C81H126N26O21S2Peso molecular:1,864.2 g/molAc-ACTH (1-17)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C97H147N29O24SPeso molecular:2,135.50 g/mol[D-Ala2,DMet5] Enkephalin
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C28H37N5O7SPeso molecular:587.70 g/molVA-β-MSH, Lipotropin-γ, Proopiomelanocortin - derived
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C126H188N36O37SPeso molecular:2,831.19 g/molα-Bag Cell Peptide (1-7)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C44H67N13O9Peso molecular:922.11 g/molSomatostatin-14 (3-14)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C71H96N16O17S2Peso molecular:1,509.78 g/molβ-Amyloid (22-35)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C59H102N16O21SPeso molecular:1,403.63 g/molPonatinib HCl
CAS:<p>BCR-ABL1 tyrosine kinase inhibitor</p>Fórmula:C29H27F3N6O·HClPureza:Min. 95%Peso molecular:569.02 g/molAquaporin-2 (254-267), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C69H116N24O22Peso molecular:1,633.84 g/mol[D-Pro194]-IL-1 β (193-195) (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C15H28N4O5Peso molecular:344.41 g/mol[Val35] -β-Amyloid (1-42)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C203H311N55O60Peso molecular:4,481.96 g/molGRF, porcine
<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Fórmula:C219H365N73O66SPeso molecular:5,108.86 g/molDynorphin A (7-17), porcine
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C65H108N22O16Peso molecular:1,453.72 g/molBiotin-RR-SRC, Insulin Receptor Tyrosine Kinase Substrate
<p>Catalogue peptide; min. 95% purity</p>Peso molecular:1,745.99 g/molBAM-12P, Bovine Adrenal Medulla Docosapeptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C62H97N21O16S1Peso molecular:1,424.66 g/molAGRP (54-82)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C137H225N39O54Peso molecular:3,282.47 g/molα-Conotoxin EI
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C83H123N27O27S5Peso molecular:2,091.39 g/molβ-Casein (90-96)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C103H175N35O27SPeso molecular:2,367.83 g/molSaposin C12
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C62H108N16O22Peso molecular:1,429.65 g/molNeo-Kyotorphin
CAS:<p>Catalogue peptide; min. 95% purity</p>Fórmula:C28H47N9O9Peso molecular:653.74 g/molN-Formyl-Nle-Leu-Phe-Nle-Tyr-Lys
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C43H65O7N9Peso molecular:824.04 g/mol[His11]Substance P
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C64H96N20O13Peso molecular:1,353.60 g/molAngiotensin I-Converting Enzyme Substrate
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C24H27N3O5Peso molecular:437.49 g/molpro-ε-Tx1X/12
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C66H126N26O16Peso molecular:1,539.90 g/molp60c-src Substrate I
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C44H60N8O11Peso molecular:877.01 g/mol[Des-Asp187]-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C42H67N9O12Peso molecular:890.06 g/molBiotin-PACAP (1-38), amide, human, ovine, rat
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C203H331N63O53S1Peso molecular:4,534.24 g/molAM 4668
CAS:<p>AM 4668 is a biochemical compound, which is derived from synthetic origins with complex organic synthesis processes. Its primary mode of action involves targeted enzymatic inhibition, effectively interacting with specific enzyme active sites to modulate biochemical pathways.</p>Fórmula:C24H19F3O4SPureza:Min. 95%Peso molecular:488.48 g/molα-Conotoxin IMI
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C52H74N20O15S4Peso molecular:1,347.58 g/molBiotin-Neurokinin B
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C67H87N15O14Peso molecular:1,326.53 g/molTyrosine Protein Kinase JAK 2
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C88H137N20O31PPeso molecular:2,082.18 g/molInfluenza A NP (366-374)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C36H59N11O17S2Peso molecular:982.06 g/molα-Neo-Endorphin (1-7)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C40H61N11O9Peso molecular:840.00 g/mol[Arg3] Substance P
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C63H98N20O13SPeso molecular:1,375.67 g/molAc-5A/5B Peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C47H73N11O18S3Peso molecular:1,176.34 g/molHylambatin
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C63H90N16O19S2Peso molecular:1,439.64 g/molβ-Amyloid (1-49)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C239H376N62O69SPeso molecular:5,253.97 g/molLaminin Penta Peptide, amide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C26H43N9O7Peso molecular:593.7 g/molα-Gliadin (57-73)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C93H136N22O27Peso molecular:1,994.25 g/molBiotin-Pancreatic Polypeptide, human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C195H301N55O56S3Peso molecular:4,407.99 g/molPRRS-PQGAB-C
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C67H90N16O19Peso molecular:1,423.56 g/molCorticotropin Releasing Factor, human, rat
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C208H344N60O63S2Peso molecular:4,757.44 g/molgp100 (178-187)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C42H71N11O14S2Peso molecular:1,018.23 g/molACTH(4-9), Tyr
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C53H68N14O12SPeso molecular:1,125.28 g/molHuman CMV Assemblin Protease Substrate (M-site)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C52H96N20O16Peso molecular:1,257.47 g/molEp-CAM (263-271)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C38H70N10O10Peso molecular:827.04 g/mol[Asn76] PTH (64-84), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C94H163N27O35Peso molecular:2,231.51 g/molα-Bag Cell Peptide (1-8)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C47H72N14O11Peso molecular:1,009.19 g/molMelanotan II, MT-Ⅱ
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C50H69N15O9Peso molecular:1,024.2 g/molPancreatic Polypeptide (31-36) (free acid) (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C36H60N12O9Peso molecular:805 g/molβ I probe
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C81H116N26O24Peso molecular:1,873.99 g/mol[Des-Gln16]-PACAP (6-27), amide, human, ovine, rat
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C116H185N31O29SPeso molecular:2,510 g/molRuxolitinib phosphate
CAS:Producto controlado<p>Ruxolitinib is a janus tyrosine kinase inhibitor active specifically on sub-types JAK1 and JAK2 with IC50 values in the nanomolar range. JAK1 and JAK2 are kinases involved in the regulation of hematopoiesis. Clinically applied to the treatment of intermediate and high-risk myelofibrosis, ruxolitinib is usually well tolerated by patients.</p>Fórmula:C17H18N6•H3O4PPureza:Min. 95%Peso molecular:404.36 g/molCalcineurin Autoinhibitory Fragment
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C124H205N39O39S2Peso molecular:2,930.38 g/molα-Endorphin
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C77H120N18O26SPeso molecular:1,745.98 g/molAc-Choline Receptor α1(129-145)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C90H136N22O28S2Peso molecular:2,038.34 g/mol2B-(pS)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C81H137N28O31PSPeso molecular:2,062.22 g/molGlycoprotein IIb Fragment (656-667)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C57H90N18O18SPeso molecular:1,347.53 g/molCaspase 1 Substrate 1m (ICE), fluorogenic
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C35H41N5O12Peso molecular:723.7 g/molSeglitide acetate
CAS:Producto controlado<p>Seglitide is a cyclic peptide that is a model system for the receptor activity of somatostatin. Somatostatin inhibits cells by binding to its receptors, which are found on the surface of endocrine cells and in the hypothalamus. Seglitide has been shown to inhibit cell growth in tissue culture and is a potent inhibitor of epidermal growth factor (EGF) production. Seglitide also activates locomotor activity in mice, suggesting that it may have some clinical relevance. Structural analysis has revealed that seglitide's amino acid sequence is similar to somatostatin's, making them closely related compounds. It also binds to DNA-dependent RNA polymerase, preventing transcription and replication.</p>Fórmula:C44H56N8O7·C2H4O2Pureza:Min. 95%Peso molecular:869.02 g/molSteroid Receptor Co-Factor Peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C79H136N26O21Peso molecular:1,786.13 g/molgp100 (639-647)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C47H79N15O11S2Peso molecular:1,094.36 g/molNES Topoisomerase II α (1017-1028)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C73H117N19O19Peso molecular:1,564.86 g/molC-Myc peptide epitope
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C51H86N12O21Peso molecular:1,203.32 g/molLHRH-Ⅲ, lamprey
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C59H75N18O14Peso molecular:1,259.4 g/molIPTG Hemidioxane
CAS:<p>A non-metabolizable allolactose analogue, widely used in molecular biology for overexpression of recombinant proteins from inducible systems under the control of lac promoter. IPTG binds to the LacI repressor and causes its release from the lac operator, allowing gene expression to take place. Present in vectors of pGEX, pGEM-T, pET, pRSET, pMAL class and others.</p>Pureza:Min. 95%Peso molecular:282.35 g/molβ-Amyloid/A4 Protein Precusor (APP) (319-335)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C86H151N31O26S2Peso molecular:2,099.48 g/mol[Ala2] Met-Enkephalin, amide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C28H38N6O6SPeso molecular:586.72 g/mol[Pyr11]-Amyloid β-Protein (11-40)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C143H226N38O39SPeso molecular:3,133.71 g/molP38 (411-425), M. leprae
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C59H100N16O20Peso molecular:1,353.55 g/molSecretin-Lys(Biotin), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C130H220N44O40Peso molecular:3,039.4 g/molPRRS-PQGAB-M
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C53H80N16O23Peso molecular:1,309.32 g/mol[D-Ala2, DArg6] Dynorphin A, (1-13), porcine
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C76H128N24O15Peso molecular:1,618.02 g/molMyristoylated ADP-Ribosylation Factor 6, myr-ARF6 (2-13)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C74H128N16O18Peso molecular:1,529.95 g/molInsulin-like Growth Factor I (57-70)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C65H104N15O23SPeso molecular:1,495.7 g/molβ-MSH, porcine
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C98H138N26O29SPeso molecular:2,176.36 g/molPRRS-PQGAB-N
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C54H76N12O24SPeso molecular:1,309.33 g/molP61 (343-355), M. leprae
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C62H107N21O24Peso molecular:1,530.67 g/molC-Reactive Protein (CRP) (77-82)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C23H40N6O10Peso molecular:560.61 g/mol[Cys(Acm)20,31]-EGF (20-31)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C63H98N16O23S3Peso molecular:1,543.77 g/mol[D-Ser13]-Somatostatin-14
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C76H104N18O19S2Peso molecular:1,637.91 g/molBiotin-Glucagon (1-29), bovine, human, porcine
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C163H239N45O51S2Peso molecular:3,709.03 g/mol[Phe22] Big Endothelin-1 (19-37), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C104H152N26O26Peso molecular:2,182.53 g/molNeurogranin (28-43)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C78H134N28O19SPeso molecular:1,800.18 g/molCripto-1, CR-1
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C86H129N27O27S2Peso molecular:2,037.26 g/molIDR-1 trifluoroacetate salt
CAS:<p>IDR-1 is a peptide that is derived from the sequence of the human typhimurium protein. IDR-1 has been shown to have anti-inflammatory properties and modulates immune responses in mice. In particular, IDR-1 inhibits neutrophil chemotaxis by inhibiting formyl peptide receptor signaling. This peptide also inhibits bacterial chemokines, which are important for the recruitment of neutrophils. IDR-1 also has been shown to be effective against methicillin-resistant Staphylococcus aureus (MRSA) and pertussis.</p>Fórmula:C65H118N18O15Pureza:Min. 95%Peso molecular:1,391.74 g/mol[Sar1]-Angiotensin I/II (1-7) amide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C40H63N13O8Peso molecular:854.02 g/molLeucokinin VII
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C40H52N10O12Peso molecular:864.9 g/mol[Tyr11]-Somatostatin-14
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C76H104N18O20S2Peso molecular:1,653.91 g/molScrambled TRAP Fragment
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C34H57N11O8Peso molecular:747.90 g/molNeuron Specific Peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C161H262N52O51S4Peso molecular:3,870.44 g/molLytic Peptide, SB - 37
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C188H320N54O45SPeso molecular:4,088.94 g/mol[Nle13]-Motillin
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C121H190N34O35Peso molecular:2,681 g/molProtein Kinase C Substrate, Glycogen Synthase (1-8)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C56H104N18O15Peso molecular:1,269.6 g/molBiotin-[Gln1]-Gastrin I (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C107H140N22O34S2Peso molecular:2,342.51 g/molα-Conotoxin GS
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C139H232N52O47S7Peso molecular:3,608.1 g/molApelin-15 (63-75)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C67H119N29O16SPeso molecular:1,618.94 g/molHIV-gp120-41-N-A
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C99H146N20O20Peso molecular:1,936.39 g/molSalusin-β
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C115H176N32O21Peso molecular:2,342.89 g/molFibrinogen β-Chain (24-42)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C86H135N25O27Peso molecular:1,951.19 g/molbFGF Inhibitory Peptide II
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C94H148N30O28SPeso molecular:2,178.48 g/molACTH (6-24), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C111H175N35O21Peso molecular:2,335.79 g/molNeurokinin Receptor (393-407), rat
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C67H87N15O14Peso molecular:1,326.53 g/molPRRS-RSAB-C
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C77H102N20O23Peso molecular:1,675.79 g/molCa-4948
CAS:<p>CA-4948 is a potent small molecule inhibitor, specifically targeting interleukin-1 receptor-associated kinase 4 (IRAK4), which plays a critical role in the Toll-like receptor (TLR) and interleukin-1 receptor (IL-1R) signaling pathways. This compound originates from targeted drug discovery efforts aimed at modulating immune-mediated pathways crucial for inflammatory responses.</p>Fórmula:C24H25N7O5Pureza:Min. 95%Peso molecular:491.5 g/molβ-Amyloid (16-20)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C35H52N6O6Peso molecular:652.84 g/molMyristoylated ADP-Ribosylation Factor 1, myr-ARF1 (2-17)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C99H157N21O22Peso molecular:1,993.49 g/mol[Met5, Lys6, Arg7] a-Neo-Endorphin (1-7)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C39H59N11O9SPeso molecular:858.04 g/mol[Pro18, Asp21] β-Amyloid (17-21), iAb5
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C33H43N5O8Peso molecular:637.74 g/mol2A/2B Dengue Protease Substrate
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C39H68N16O11Peso molecular:937.08 g/molAcetalin 3, Opioid Receptor Antagonist 3
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C42H61N114O8S2Peso molecular:912.15 g/molP75-TNFR Fragment
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C53H85N15O15SPeso molecular:1,204.42 g/mol[D-Pro2,D-Phe7,D-Trp9]-Substance P
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C72H105N19O13SPeso molecular:1,476.82 g/molHJ Inhibitor Peptide 2
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C48H61N13O7SPeso molecular:964.16 g/molβ-Amyloid (8-38)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C147H227N39O43SPeso molecular:3,260.75 g/molBiotin-Intermedin (rat)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C236H377N77O66S3Peso molecular:5,445.29 g/molMagainin Spacer Peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C97H150N28O39Peso molecular:2,332.39 g/molBiotin-Neuromedin S (rat)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C67H87N15O14Peso molecular:1,326.53 g/mol[Tyr8,Nle11] Substance P
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C64H100N18O14Peso molecular:1,345.62 g/mol5A/5B Peptide (1)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C46H72N10O18S2Peso molecular:1,117.24 g/molCys-GM-CSF (17-31)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C76H133N28O25SPeso molecular:1,871.14 g/molTRH (free acid)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C16H21N7O3Peso molecular:363.41 g/molAdrenomedullin (1-52), porcine
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C262H403N79O76S3Peso molecular:5,971.67 g/mol[Ac-Cys4,DPhe7,Cys10] a-MSH (4-13), amide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C61H88N18O13S2Peso molecular:1,345.61 g/molLeptin (22-56), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C171H298N50O56Peso molecular:3,950.49 g/molBiotin-Dynorphin A (1-17)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C109H169N33O25SPeso molecular:2,373.83 g/mol(D-Ala2)-GRF (1-29) amide (human)
CAS:<p>Please enquire for more information about (D-Ala2)-GRF (1-29) amide (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C149H246N44O42SPureza:Min. 95%Peso molecular:3,357.88 g/molAcetyl-(D-Phe2)-GRF (1-29) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-(D-Phe2)-GRF (1-29) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C157H252N44O43SPureza:Min. 95%Peso molecular:3,476.02 g/molH-Arg(Pbf)-OtBu·HCl
CAS:<p>Please enquire for more information about H-Arg(Pbf)-OtBu·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C23H38N4O5S·HClPureza:Min. 95%Forma y color:PowderPeso molecular:519.1 g/molH-Val-Val-Val-OH
CAS:<p>H-Val-Val-Val-OH is an enantiomer of H-Val-Gly-Thr-Phe, a linear model of the apical region of the Caco2 cell. It is also a monolayer that has hydrogen bonds with other molecules. Molecular modeling shows that H-Val-Val-Val-OH inhibits the uptake of glucose by Caco2 cells. The transport properties of this molecule are not well understood, but it may inhibit glucose transport in the small intestine by binding to glucose transporter 2 (GLUT2). Chromatographic methods have been used to analyze H-Val-Val-Val-OH and its inhibition on growth factor activity.</p>Fórmula:C15H29N3O4Pureza:Min. 95%Peso molecular:315.41 g/molH-Ile-Leu-OH
CAS:<p>H-Ile-Leu-OH is a molecule that has been shown to inhibit the uptake of glucose in muscle cells. It also inhibits protein synthesis and antioxidant system, which may be due to its ability to inhibit the uptake of glucose in muscle cells. This molecule is not active against cancer cells, but it has been shown to have anticancer effects in animals. H-Ile-Leu-OH is synthesized by enzymatic hydrolysis of branched-chain amino acids. It has been shown that the uptake rate of this molecule can be increased by using plasma samples from cancer patients as well as animals with cancer.</p>Fórmula:C12H24N2O3Pureza:Min. 95%Peso molecular:244.33 g/molH-D-Pro-Phe-Arg-pNA·2 HCl
CAS:<p>Pro-Phe-Arg-pNA·2 HCl is a kallikrein substrate used to assay the activity of activated Hageman factor, that is the plasma protein and a serine protease also known as coagulation factor XII.</p>Fórmula:C26H34N8O5·2HClPureza:Min. 95%Peso molecular:611.52 g/molS-Sulfo-L-cysteine sodium
CAS:<p>S-sulfo-L-cysteine sodium is a high purity antibody that can be used as a research tool. It has been shown to interact with ion channels and protein interactions. S-sulfo-L-cysteine sodium is also used in the study of cell biology, pharmacology, and receptor binding. This substance is a ligand that activates or inhibits certain receptors, specifically peptides and ion channels. The CAS number for this molecule is 7381-67-1.</p>Fórmula:C3H6NNaO5S2Pureza:Min. 95%Peso molecular:223.2 g/molFmoc-Val-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Val-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Boc-His(1-Mts)-OH·DCHA
CAS:Producto controlado<p>Please enquire for more information about Boc-His(1-Mts)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C20H27N3O6S·C12H23NPureza:Min. 95%Peso molecular:618.83 g/mol1,2-Dilauroyl-rac-glycero-3-phosphocholine
CAS:<p>1,2-Dilauroyl-rac-glycero-3-phosphocholine (DLPC) is a synthetic phospholipid that exhibits significant cytotoxicity against hyperproliferative cells. DLPC has been shown to inhibit the activity of the enzyme sphingosine 2-phosphate (S2P) and cell factor, both of which are important in signal transduction pathways. DLPC is capable of inducing phase transition at a temperature close to body temperature, making it biocompatible for use as a topical or injectable drug. It has also been shown to be effective in treating infectious diseases such as HIV and malaria, due to its ability to bind with basic proteins found on the surface of these viruses.</p>Fórmula:C32H64NO8PPureza:Min. 95%Peso molecular:621.83 g/molZ-Gly-Ala-OH
CAS:<p>Z-Gly-Ala-OH is an amide that is synthesized by the solid-phase synthesis of a protected amino acid. The amino acid sequence was determined by sequencing the product and comparing it to the amino acid composition of known glycyl-amides. The enzyme active site was found to be located on the side chain of Gly, which is a polar residue. This catalytic site is only occupied in one orientation, with Ala occupying the opposite side chain position. The yields for this reaction are very high and are not affected by changes in temperature or pH. Z-Gly-Ala-OH has a chiral center at position 3 and can exist as two enantiomers, Z-(+)-glycylalanine and its mirror image, Z-(−)-glycylalanine.</p>Fórmula:C13H16N2O5Pureza:Min. 95%Peso molecular:280.28 g/molL-α-Phosphatidylserine sodium, porcine brain
CAS:<p>L-alpha-Phosphatidylserine sodium salt, derived from porcine brain, is a research chemical that has shown promising potential in various fields. It has been studied for its role in HIV-1 infection, where it has been found to inhibit the fusion of the virus with host cells. Additionally, L-alpha-Phosphatidylserine sodium salt has shown positive effects on spermatozoa motility and fertility. In cancer research, L-alpha-Phosphatidylserine sodium salt has been investigated for its ability to enhance the efficacy of certain anti-cancer drugs. It is believed to work by increasing the uptake of these drugs into cancer cells, thereby improving their effectiveness. This compound also plays a role in neurological health. It is involved in the synthesis of steroidal hormones and neurotransmitters such as dopamine. Studies have suggested that L-alpha-Phosphatidylserine sodium salt may support cognitive function and memory. Furthermore, L-alpha-Ph</p>Pureza:Min. 95%Band 3 Protein (547-553) (human)
CAS:<p>Please enquire for more information about Band 3 Protein (547-553) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C41H63N11O11Peso molecular:886.02 g/mol1-Oleoyl-3-palmitoyl-rac-glycero-2-phosphoethanolamine
CAS:<p>Please enquire for more information about 1-Oleoyl-3-palmitoyl-rac-glycero-2-phosphoethanolamine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C39H76NO8PPureza:Min. 95%Peso molecular:718 g/molTropifexor
CAS:<p>Tropifexor is a small molecule that inhibits the replication of human pathogens by binding to DNA and inhibiting DNA synthesis. It has been shown to inhibit the growth of a broad range of human pathogens, including Mycobacterium tuberculosis, Mycobacterium avium complex, Staphylococcus aureus, Streptococcus pneumoniae, and Salmonella enterica. Tropifexor has also been shown to reduce liver steatosis in mice and to increase mitochondrial membrane potential in cultured cells. Tropifexor is not genotoxic and does not cause metabolic disorders in animals. Tropifexor is an inhibitor of glucagon-like peptide-1 receptor agonists (GLP-1R).</p>Fórmula:C29H25F4N3O5SPureza:Min. 95%Peso molecular:603.59 g/molN-(3-(2-Furyl)Acryloyl-Ala-Lys TFA salt
CAS:<p>FA-Ala-Lys-OH is a lysine derivative with a molecular weight of 243.2 daltons and a pKa of 6.5. It has been shown to be biologically active in humans and animals, and can be used as an amino acid supplement for patients with liver disease or kidney failure who require dialysis. FA-Ala-Lys-OH binds to the creatine kinase receptor on the surface of cells and causes cell lysis, which may be due to its ability to bind to the enzyme's allosteric site. This compound also has anti-viral properties, inhibiting the growth of recombinant virus mcf-7 in vitro by binding to erythrocyte membranes and disrupting protein synthesis. The 6-Fluoro-3-indoxyl beta D galactopyranoside is an antituberculosis drugs that belongs to the class of rifamycins. Rifapentine inhibits bacterial</p>Fórmula:C16H23N3O5Pureza:Min. 95%Peso molecular:337.37 g/molH-Ile-Met-OH
CAS:<p>H-Ile-Met-OH is a cytosolic protein that is found in the cytosolic domain of plant cells. H-Ile-Met-OH is an enzyme that catalyzes the conversion of HMBP to Met, which is an intermediate in the biosynthesis of methionine. The frequency and sequence of H-Ile-Met-OH has been analyzed in animals, plants, and fungi. Bioinformatics studies have shown that H-Ile-Met-OH has a vacuolar function, which can be seen by its sequence similarity to other vacuolar proteins.</p>Fórmula:C11H22N2O3SPureza:Min. 95%Peso molecular:262.37 g/molSB 258585 hydrochloride
CAS:<p>SB 258585 hydrochloride is a positron-emitting radiotracer that binds to dopamine D2 receptors in the brain. It has been used for positron emission tomography (PET) imaging studies of the human brain. SB 258585 hydrochloride is taken up by the brain and specifically targets striatal regions. It can be used in clinical development as an unlabelled surrogate marker of dopamine D2 receptors. This drug has been validated for use in macaque models and shown to be a molecular imaging agent with high sensitivity, specificity, and good pharmacokinetic properties.</p>Fórmula:C18H22IN3O3S·HClPureza:Min. 95%Peso molecular:523.82 g/molChlorpropamide
CAS:<p>Hypoglycemic agent</p>Fórmula:C10H13ClN2O3SPureza:Min. 95%Forma y color:White Off-White PowderPeso molecular:276.74 g/molMozavaptan
CAS:Producto controlado<p>Mozavaptan is a pharmacological agent that acts as a vasopressin V2 receptor antagonist. It is derived through synthetic chemical processes designed to target specific neurohormonal pathways in the body. Mozavaptan exerts its effects by inhibiting the action of vasopressin, a hormone that promotes water reabsorption in the kidneys. By blocking the vasopressin receptors, it enhances water excretion and corrects imbalances in electrolyte levels, particularly addressing conditions like hyponatremia.</p>Fórmula:C27H29N3O2Pureza:Min. 98 Area-%Forma y color:PowderPeso molecular:427.54 g/mol(D-Asp1)-Amyloid b-Protein (1-42)
CAS:<p>Please enquire for more information about (D-Asp1)-Amyloid b-Protein (1-42) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C203H311N55O60SPureza:Min. 95%Peso molecular:4,514.04 g/molCl2A-SN-38
CAS:<p>Cl2A-SN-38 is an innovative antibody-drug conjugate (ADC), which is derived from a targeted delivery system designed to enhance the therapeutic index of chemotherapeutic agents. The product is synthesized through the chemical conjugation of the monoclonal antibody Cl2A with the potent topoisomerase I inhibitor, SN-38. This conjugation is achieved using a stable linker that facilitates selective delivery of SN-38 to cancer cells expressing the target antigen, thus minimizing systemic toxicity.</p>Fórmula:C73H97N11O22Pureza:Min. 95%Peso molecular:1,480.6 g/molAc-Arg-Leu-Arg-AMC trifluoroacetate salt
CAS:<p>Ac-Arg-Leu-Arg-AMC trifluoroacetate salt is a mitochondrial biogenesis activator that has been shown to increase the levels of proteins in the mitochondria. These proteins are required for mitochondrial membrane potential, ATP production, and protein homeostasis. Ac-Arg-Leu-Arg-AMC trifluoroacetate salt has been shown to increase the number of pluripotency markers in human liver cells and to reduce insulin resistance in animals. The drug also increases the expression of ubiquitin ligases and proteasomes, which are enzymes that degrade damaged proteins. Ac-Arg-Leu-Arg-AMC trifluoroacetate salt may be used for treating liver diseases or disorders as well as obesity.</p>Fórmula:C30H46N10O6•C2HF3O2Pureza:Min. 96 Area-%Forma y color:PowderPeso molecular:756.77 g/molLanabecestat
CAS:<p>Lanabecestat is an investigational drug, classified as a beta-secretase (BACE) inhibitor, which is derived from synthetic chemical processes. Its mode of action involves inhibiting the enzyme beta-secretase, which plays a crucial role in the amyloidogenic pathway by cleaving amyloid precursor protein (APP) into amyloid-beta peptides. The accumulation of these peptides is a hallmark of Alzheimer's disease pathology.</p>Fórmula:C26H28N4OPureza:Min. 95%Forma y color:PowderPeso molecular:412.53 g/molH-Glu(Glu(Glu-OH)-OH)-OH trifluoroacetate salt
CAS:<p>H-Glu(Glu(Glu-OH)-OH)-OH trifluoroacetate salt is a casein that is used as a model system for pancreatic β-cells. It has been shown to induce cell apoptosis in malignant cells and sequences that are associated with the development of pancreatic cancer. H-Glu(Glu(Glu-OH)-OH)-OH trifluoroacetate salt also induces endothelial cell proliferation and decreases cell function, which may be due to its ability to promote uptake of this compound.</p>Fórmula:C15H23N3O10Pureza:Min. 95%Peso molecular:405.36 g/molBIBP 3226 trifluoroacetate
CAS:<p>Antagonist of neuropeptide receptor Y1</p>Fórmula:C27H31N5O3•CF3CO2HPureza:Min. 95%Forma y color:PowderPeso molecular:587.6 g/molPreproenkephalin B (186-204), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C78H115N21O36SPeso molecular:1,954.97 g/molOV-1, Sheep
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C105H188N34O21Peso molecular:2,262.88 g/molCIN16645
CAS:<p>CIN16645 is a peptide inhibitor of protein interactions. It has been shown to bind to the receptor and inhibit the activation of ion channels, which are proteins that form pores in cell membranes to allow ions to pass through. CIN16645 is a ligand for the receptor and can be used as a research tool for studying ion channels. The purity of this product is high, with no detectable impurities. This product is intended for use in life sciences research applications, such as antibody production and cell biology research.</p>Fórmula:C50H93NO9Pureza:Min. 95%Peso molecular:852.3 g/molMC-Gly-Gly-Phe-Gly-NH-CH2-O-CH2COOH
CAS:<p>This activated peptide-cleavable linker has an extended functionality linked to the Gly in the peptide sequence. This is quite useful in conjugation in enzymatically cleavable environments inside target cells for controlled release of the drug or payload.</p>Fórmula:C28H36N6O10Pureza:Min. 95%Peso molecular:616.6 g/molγ-Bag Cell Peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C31H51N11O8Peso molecular:705.82 g/molPSY1 Precursor Peptide
<p>Please enquire for more information about PSY1 Precursor Peptide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C80H114N22O28Pureza:Min. 95%Peso molecular:1,849.91 g/mol(Lauroyl-Cys-Tyr-Gly(-Glu-Glu-Asn-Val)6-OH)2 (Disulfide bond)
CAS:<p>Please enquire for more information about (Lauroyl-Cys-Tyr-Gly(-Glu-Glu-Asn-Val)6-OH)2 (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C280H428N66O120S2Pureza:Min. 95%Peso molecular:6,702.9 g/molPhenylalanine-free protein 115 120 125
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C85H131N21O26SPeso molecular:1,895.18 g/molYK11
CAS:Producto controlado<p>YK11 is a synthetic gene-selective androgen receptor modulator, which is derived from steroidal structures and designed to modulate specific pathways. This compound is characterized by its unique ability to act as a partial agonist/antagonist at the androgen receptor, with a focus on inhibiting the activity of myostatin, a regulatory protein that limits muscle growth.</p>Fórmula:C25H34O6Pureza:Min. 95%Peso molecular:430.53 g/mol[Arg0] Met-Enkephalin
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C33H47N9O8SPeso molecular:729.86 g/molDynorphin A (3-8), porcine
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C35H60N12O7Peso molecular:760.94 g/molN-10 Region of TRAP
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C51H78N11O21SPeso molecular:1,213.32 g/molgp100 (619-627)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C49H82N14O14SPeso molecular:1,123.35 g/mol[Met5, Lys6,7] a-Neo-Endorphin (1-7)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C39H59N9O9SPeso molecular:830.02 g/molMARCKS Protein (159-165)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C45H72N10O9Peso molecular:897.14 g/molα-casozepine
CAS:<p>CAS No. 117592-45-7 is an ion channel activator that belongs to the group of peptides. It is a high purity product with a purity of 99.5% and has been purified by HPLC. CAS No. 117592-45-7 activates voltage-gated sodium channels in neuronal tissue, which may be due to its ability to bind to the receptor site and activate it, or by binding to the protein and changing its conformation to allow ions through the channel pore. The specificity of this ligand has been shown using antibody inhibition assays on rat erythrocytes and human erythrocytes.</p>Fórmula:C60H94N14O16Pureza:Min. 95%Peso molecular:1,267.5 g/molH-D-Val-Leu-Lys-pNA·2 HCl
CAS:<p>D-Val-Leu-Lys-p-nitroanilide is a selective colorimetric substrate for plasmin used to determine plasmin formation from plasminogen in amidolytic activity assays and plasminogen activating assays. Plasmin is a plasma serine protease whose main role is to dissolve fibrin blood clots. After cleavage by plasmin, the protease activity is quantified by the release of p-nitroaniline (pNA) from the substrate.</p>Fórmula:C23H38N6O5·2HClPureza:Min. 95%Peso molecular:551.51 g/molCJC-1295-no DAC acetate
CAS:<p>CJC-1295-no DAC acetate is a synthetic peptide, which is a modified form of the growth hormone-releasing hormone (GHRH) analog, derived from recombinant sources. Its mode of action involves binding to the growth hormone secretagogue receptor, thereby promoting the release of growth hormone from the anterior pituitary. This mechanism of action facilitates the increase of circulating insulin-like growth factor 1 (IGF-1), enhancing various physiological processes.In scientific research, CJC-1295-no DAC acetate is primarily utilized to study its potential effects on muscle growth, body composition, and overall metabolic function. It is also used to explore its ability to modulate the aging process through growth hormone pathways. Unlike its counterpart with DAC, this variant has a shorter half-life, thus allowing researchers to examine the temporal effects of pulsatile GH release. Furthermore, its applications extend to understanding disorders related to growth hormone deficiencies, contributing valuable insights into therapeutic strategies for such conditions. The peptide serves as an important tool in endocrinology research, providing a platform for studying the complex interactions between hormonal regulation and physiological outcomes.DAC is 'drug affinity complex' and in this peptide works by not having a lysine at the end of the sequence.</p>Fórmula:C152H252N44O42•(C2H4O2)xPureza:Min. 95%Peso molecular:3,367.9 g/molMyelin Oligodendrocyte Glycoprotein (35-55) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Myelin Oligodendrocyte Glycoprotein (35-55) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C120H179N35O28SPureza:Min. 95%Peso molecular:2,591.99 g/mol(S)-Luliconazole
CAS:<p>(S)-Luliconazole is an antifungal agent that is synthesized from an imidazole compound. This compound is biphenyl in structure and is often derived through chiral synthesis techniques to isolate the (S)-enantiomer, which is the active form that enhances pharmacological effects. Its mode of action involves inhibiting the enzyme lanosterol 14α-demethylase, an essential component in fungal cell membrane synthesis. This inhibition disrupts the production of ergosterol, a critical sterol in fungal membranes, ultimately leading to increased membrane permeability and cell death.</p>Fórmula:C14H9Cl2N3S2Pureza:Min. 95%Peso molecular:354.3 g/molAc-(6-O-stearoyl)-muramyl-Ala-D-Glu-NH2
CAS:<p>Please enquire for more information about Ac-(6-O-stearoyl)-muramyl-Ala-D-Glu-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C37H66N4O12Pureza:Min. 95%Forma y color:White To Off-White SolidPeso molecular:758.94 g/mol(D-Arg2, Sar 4)-Dermorphin (1-4) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Arg2, Sar 4)-Dermorphin (1-4) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Peso molecular:555.63Lobeglitazone
CAS:<p>Lobeglitazone is a dipeptidyl peptidase-4 (DPP-4) inhibitor that stimulates glucagon-like peptide-1 receptor (GLP-1R). It is used for the treatment of type 2 diabetes and has been shown to inhibit the proliferation of vascular smooth muscle cells and reduce atherosclerotic lesion size. Lobeglitazone also has an effect on matrix metalloproteinases, which may be related to its ability to inhibit the development of renal fibrosis. Lobeglitazone modulates energy metabolism by increasing insulin sensitivity and reducing insulin levels in blood. This drug also reduces blood pressure and prevents congestive heart failure by lowering blood pressure and improving left ventricular function. The concentration–time curve of lobeglitazone can be monitored with a test that measures serum concentrations every 15 minutes for 24 hours after administration. Lobeglitazone should not be taken by people with metabolic disorders or kidney dysfunction.</p>Pureza:Min. 95%N,N'-1,2-ethanediylbis[N-[(2-hydroxyphenyl)methyl]-glycine
CAS:<p>N,N'-1,2-Ethanediylbis[N-[(2-hydroxyphenyl)methyl]-glycine is a research tool that is used to study the activation of receptors and ion channels. It can also be used to study protein interactions and pharmacology.</p>Fórmula:C20H24N2O6Pureza:Min. 95%Peso molecular:388.4 g/molAmyloid β-Protein (1-42) hydrochloride salt
CAS:<p>Key subunit of extracellular plaques found in the brains of patients with Alzheimer's disease; Hydrochloride salt</p>Fórmula:C203H311N55O60SPureza:Min. 95%Peso molecular:4,514.04 g/molTrehalose 6-decanoate
CAS:<p>Trehalose 6-decanoate is a specialized sugar ester, which is a derivative of the disaccharide trehalose. It is synthesized typically through esterification processes involving enzymatic or chemical methods, where a decanoic acid chain is introduced to the trehalose molecule. This modification results in altered physicochemical properties compared to the native sugar.</p>Fórmula:C22H40O12Pureza:Min. 95%Peso molecular:496.55 g/mol
![[D-Cys6,Asn7,D-Ala11,Cys14]-Bombesin (6-14)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00137.webp&w=3840&q=75)
![[Phe2]-TRH](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00173.webp&w=3840&q=75)
![[D-Trp2,7,9]-Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00654.webp&w=3840&q=75)
![BPDEtide [RKISASEFDRPLR]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00667.webp&w=3840&q=75)
![[Des-Leu26,Cys(Acm)20,31]-EGF (20-31)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00264.webp&w=3840&q=75)
![[D-Ala2,DMet5] Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00835.webp&w=3840&q=75)
![[D-Pro194]-IL-1 β (193-195) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00516.webp&w=3840&q=75)
![[Val35] -β-Amyloid (1-42)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00311.webp&w=3840&q=75)
![[His11]Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00676.webp&w=3840&q=75)
![[Des-Asp187]-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00513.webp&w=3840&q=75)
![[Arg3] Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00678.webp&w=3840&q=75)
![[Asn76] PTH (64-84), human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00372.webp&w=3840&q=75)
![[Des-Gln16]-PACAP (6-27), amide, human, ovine, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00400.webp&w=3840&q=75)
![[Ala2] Met-Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00854.webp&w=3840&q=75)
![[Pyr11]-Amyloid β-Protein (11-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00202.webp&w=3840&q=75)
![[D-Ala2, DArg6] Dynorphin A, (1-13), porcine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00836.webp&w=3840&q=75)
![[Cys(Acm)20,31]-EGF (20-31)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00265.webp&w=3840&q=75)
![[D-Ser13]-Somatostatin-14](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00217.webp&w=3840&q=75)
![[Phe22] Big Endothelin-1 (19-37), human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00505.webp&w=3840&q=75)
![[Sar1]-Angiotensin I/II (1-7) amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00205.webp&w=3840&q=75)
![[Tyr11]-Somatostatin-14](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00219.webp&w=3840&q=75)
![[Nle13]-Motillin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00402.webp&w=3840&q=75)
![Biotin-[Gln1]-Gastrin I (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00106.webp&w=3840&q=75)
![[Met5, Lys6, Arg7] a-Neo-Endorphin (1-7)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00876.webp&w=3840&q=75)
![[Pro18, Asp21] β-Amyloid (17-21), iAb5](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00575.webp&w=3840&q=75)
![[D-Pro2,D-Phe7,D-Trp9]-Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00653.webp&w=3840&q=75)
![[Tyr8,Nle11] Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00677.webp&w=3840&q=75)
![[Cit5]-TRAP-5](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00717.webp&w=3840&q=75)
![[Ac-Cys4,DPhe7,Cys10] a-MSH (4-13), amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00024.webp&w=3840&q=75)
![[Arg0] Met-Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00699.webp&w=3840&q=75)
![[Met5, Lys6,7] a-Neo-Endorphin (1-7)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00874.webp&w=3840&q=75)
![N,N'-1,2-ethanediylbis[N-[(2-hydroxyphenyl)methyl]-glycine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FKBA99829.webp&w=3840&q=75)
