Compuestos y reactivos bioquímicos
Los bioquímicos y reactivos son sustancias fundamentales para la investigación y el desarrollo en campos como la biotecnología, la biología molecular, la farmacología y la medicina. Estos productos son esenciales para una variedad de aplicaciones, incluyendo la síntesis de compuestos, el análisis de muestras biológicas, la investigación de procesos metabólicos y la producción de medicamentos. En CymitQuimica, ofrecemos una amplia selección de bioquímicos y reactivos de alta calidad y pureza, adecuados para diversas necesidades científicas e industriales. Nuestro catálogo incluye enzimas, anticuerpos, ácidos nucleicos, aminoácidos, y muchos otros productos, todos diseñados para apoyar a los investigadores y profesionales en sus proyectos de investigación y desarrollo, asegurando resultados confiables y reproducibles.
Subcategorías de "Compuestos y reactivos bioquímicos"
- Biomoléculas(99.116 productos)
- Por objetivo biológico(99.076 productos)
- Según efectos farmacológicos(6.785 productos)
- Crioconservantes(21 productos)
- Desinfectantes y compuestos relacionados(28 productos)
- Hormonas(346 productos)
- Biología Vegetal(6.698 productos)
- Metabolitos secundarios(14.220 productos)
Se han encontrado 130579 productos de "Compuestos y reactivos bioquímicos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
[D-Arg1,D-Phe5,D-Trp7,11]-Substance P
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C75H101N19O12Peso molecular:1,460.76 g/mol[Phe1376]-Fibronectin Fragment (1371-1382)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C63H103N25O19Peso molecular:1,514.68 g/mol[Leu144,Arg147]-Myelin Proteolipid Protein(139-151)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C67H110N20O17Peso molecular:1,467.75 g/molCys-Gly-Lys-Lys-Gly-Amyloid β-Protein (35-40)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C43H79N13O12S2Peso molecular:1,034.31 g/molAGRP (25-51)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C130H221N37O35SPeso molecular:2,894.43 g/molMOPSO
CAS:<p>MOPSO, also known as 3-(N-Morpholino)-2-hydroxy-1-propanesulfonic acid, a a morpholinic buffer with an optimal pH range of 6.2-7.6 and a pKa of 6.87. It has poor metal ion coordination and can be used in protein work and chromatography.</p>Fórmula:C7H15NO5SPureza:Min. 95%Forma y color:PowderPeso molecular:225.26 g/molFITC-β-Ala-Amyloid β-Protein (1-40)
CAS:<p>Please enquire for more information about FITC-beta-Ala-Amyloid beta-Protein (1-40) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C218H311N55O64S2Pureza:Min. 95%Peso molecular:4,790.27 g/molBoc-N-Me-D-Tyr-OH·DCHA
CAS:Producto controlado<p>Please enquire for more information about Boc-N-Me-D-Tyr-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C15H21NO5·C12H23NPureza:Min. 95%Peso molecular:476.65 g/molDABCYL-Lys-HCoV-SARS Replicase Polyprotein 1ab (3235-3246)-Glu-EDANS trifluoroacetate salt
CAS:<p>DABCYL-Lys-HCoV-SARS Replicase Polyprotein 1ab (3235-3246)-Glu-EDANS trifluoroacetate salt is a fluorescent substrate for the SARS coronavirus. This compound is an inhibitor of the enzyme that is the target of a drug candidate that inhibits the replication of this virus. Molecular docking studies have shown that DABCYL-Lys-HCoV-SARS Replicase Polyprotein 1ab (3235-3246)-Glu-EDANS trifluoroacetate salt binds to 3clpro, which is part of the active site of the enzyme’s catalytic pocket. Inhibition activity was seen in experiments using recombinant proteins, and kinetic analysis showed this inhibitor has a Ki value of 0.7 mM.</p>Fórmula:C95H141N25O24S2·C2HF3O2Pureza:Min. 95 Area-%Forma y color:PowderPeso molecular:2,195.47 g/molN-Acetyl-L-norleucyl-L-a-aspartyl-L-histidyl-3-(2-naphthalenyl)-D-alanyl-L-arginyl-L-tryptophyl-L-lysinamide-(2,7) -lactam
CAS:<p>Please enquire for more information about N-Acetyl-L-norleucyl-L-a-aspartyl-L-histidyl-3-(2-naphthalenyl)-D-alanyl-L-arginyl-L-tryptophyl-L-lysinamide-(2,7) -lactam including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C54H71N15O9Pureza:Min. 95%Peso molecular:1,074.24 g/molCaspase 2 Substrate, chromogenic
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C31H43N9O14Peso molecular:765.7 g/mol(D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH
CAS:<p>Please enquire for more information about (D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C59H84N18O14Pureza:Min. 95%Peso molecular:1,269.41 g/molFmoc-D-Pro-D-Pro-D-Pro-D-Pro-OH
CAS:<p>Please enquire for more information about Fmoc-D-Pro-D-Pro-D-Pro-D-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C35H40N4O7Pureza:Min. 95 Area-%Forma y color:PowderPeso molecular:628.71 g/molFeline Calicivirus VP1 Antigen, recombinant
<p>Potentially suitable for lateral flow, ELISA and IFA applications</p>Pureza:Min. 95%Abz-Ala-Gly-Leu-Ala-p-nitrobenzylamide
CAS:<p>Benzamidine is a benzamidase inhibitor that competitively binds to bacterial enzymes such as metalloendopeptidases and matrix metalloproteinases. It inhibits the degradation of collagen, resulting in a higher concentration of soluble extract. This drug also has an effect on spermatozoa, which may be due to its ability to inhibit bacterial enzymes that are involved with uptake and preload. Benzamidine has been shown to have a pH optimum of 8-9 and is most active at this pH range.</p>Fórmula:C28H37N7O7Pureza:Min. 95%Peso molecular:583.64 g/molFluorescein-6-carbonyl-Val-Glu(OMe)-Ile-DL-Asp(OMe)-fluoromethylketone
CAS:<p>Please enquire for more information about Fluorescein-6-carbonyl-Val-Glu(OMe)-Ile-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C44H49FN4O14Pureza:Min. 95%Peso molecular:876.88 g/molBiotin-MBP(94-102)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C49H84N20O13SPeso molecular:1,193.41 g/molN-[(2RS,3RS)-2,3,4-Trihydroxy-butyl]-Val-Leu-anilide
CAS:<p>Please enquire for more information about N-[(2RS,3RS)-2,3,4-Trihydroxy-butyl]-Val-Leu-anilide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C21H35N3O5Pureza:Min. 95%Peso molecular:409.52 g/molFeline Herpes Virus 1 Antigen, recombinant
<p>Potentially suitable for lateral flow, ELISA and IFA applications</p>Pureza:Min. 95%Mirogabalin
CAS:<p>Blocks calcium channels by binding to α₂δ subunits</p>Fórmula:C12H19NO2Pureza:Min. 95%Peso molecular:209.28 g/molAquaporin-2 (255-271), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C77H129N25O26Peso molecular:1,821.04 g/molBig Endothelin-1 (1-39), porcine
<p>Please enquire for more information about Big Endothelin-1 (1-39), porcine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>H-Ile-Arg-Pro-OH
CAS:<p>Please enquire for more information about H-Ile-Arg-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C17H32N6O4Pureza:Min. 95%Peso molecular:384.47 g/molOrexin A trifluoroacetate
CAS:<p>Please enquire for more information about Orexin A trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C152H243N47O44S4•(C2HF3O2)xPureza:Min. 95%Nps-Lys(Boc)-OH·DCHA
CAS:Producto controlado<p>Please enquire for more information about Nps-Lys(Boc)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C17H25N3O6S·C12H23NPureza:Min. 95%Peso molecular:580.78 g/molWX 671
CAS:<p>WX 671 is an oral prodrug that is metabolized to the active compound, WX 672. It has potent anticancer effects and inhibits the growth of cancer cells by blocking the enzyme activity. The biological sample was collected from a fetal bovine and was found to inhibit squamous carcinoma in rats. WX 671 also has clinical relevance as it has been shown to induce apoptosis in tumor cells and inhibit inflammatory bowel disease (IBD). !--</p>Fórmula:C32H47N5O6SPureza:Min. 95%Peso molecular:629.81 g/molMca-Gly-Ala-Lys(Ac)-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Gly-Ala-Lys(Ac)-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C54H85N19O13Pureza:Min. 95%Peso molecular:1,208.37 g/molE3 Ligase ligand 1a
CAS:<p>E3 Ligase Ligand 1a is a small molecule ligand, which is typically synthesized in a laboratory setting. The ligand acts as a recruiter for E3 ubiquitin ligases, proteins that play a pivotal role in the ubiquitin-proteasome pathway. By binding to an E3 ligase, the ligand can facilitate the ubiquitination and subsequent degradation of target proteins. This mechanism is central to modulating protein levels within a cell, enabling researchers to study protein function and regulation dynamically.</p>Fórmula:C23H32N4O3SPureza:Min. 95%Peso molecular:444.6 g/molAmyloid β/A4 Protein Precursor770 (740-770) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta/A4 Protein Precursor770 (740-770) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C162H243N45O52S2Pureza:Min. 95%Peso molecular:3,717.07 g/molAmyloid β-Protein (22-35)
CAS:<p>Please enquire for more information about Amyloid beta-Protein (22-35) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C59H102N16O21SPureza:Min. 95%Peso molecular:1,403.6 g/molBoc-Leu-Gly-Arg-pNA
CAS:<p>a chromogenic substrate for horseshoe crab clotting enzyme, which is used in quantitative assays of endotoxin.</p>Fórmula:C25H40N8O7Forma y color:PowderPeso molecular:564.63 g/mol(Cys26)-Amyloid b-Protein (1-40) (Dimer) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Cys26)-Amyloid b-Protein (1-40) (Dimer) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C388H588N106O114S4Pureza:Min. 95%Peso molecular:8,689.73 g/mol(Glu20)-Amyloid b-Protein (1-42)
CAS:<p>Please enquire for more information about (Glu20)-Amyloid b-Protein (1-42) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C199H309N55O62SPureza:Min. 95%Peso molecular:4,495.98 g/mol(7-Diethylaminocoumarin-3-yl)carbonyl-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (7-Diethylaminocoumarin-3-yl)carbonyl-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C208H308N54O61SPureza:Min. 95%Peso molecular:4,573.06 g/molFITC-b-Ala-Amyloid b-Protein (1-42) ammonium salt
CAS:<p>Please enquire for more information about FITC-b-Ala-Amyloid b-Protein (1-42) ammonium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C227H327N57O66S2Pureza:Min. 95%Peso molecular:4,974.5 g/mol(Pro18,Asp21)-Amyloid b-Protein (17-21) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pro18,Asp21)-Amyloid b-Protein (17-21) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C33H43N5O8Pureza:Min. 95%Peso molecular:637.72 g/mol(Lys15)-Amyloid b-Protein (15-21) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Lys15)-Amyloid b-Protein (15-21) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C44H69N9O8Pureza:Min. 95%Peso molecular:852.07 g/mol(Val671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Val671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C51H82N14O18Pureza:Min. 95%Peso molecular:1,179.28 g/molAmyloid β-Protein (1-16) trifluoroacetate salt
CAS:<p>Amyloid beta-Protein (1-16) trifluoroacetate salt is a modified form of amyloid beta protein. It is synthesized by the modification of amino acids with trifluoroacetic acid and can be used to study the pathogenesis of Alzheimer's disease. Amyloid beta-Protein (1-16) trifluoroacetate salt has been shown to bind to β-amyloid, which is thought to be the main component of plaques in Alzheimer's disease. This binding inhibits the formation of β-amyloid aggregates, which are associated with neurotoxicity and neuronal cell death.</p>Fórmula:C84H119N27O28Pureza:Min. 95%Peso molecular:1,955.01 g/molZ-D-Arg-Gly-Arg-pNA dihydrochloride
CAS:<p>Please enquire for more information about Z-D-Arg-Gly-Arg-pNA dihydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C28H39N11O7·2HClPureza:Min. 95%Peso molecular:714.6 g/molFmoc-Phe-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Phe-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Dermorphin
CAS:<p>A hepta-peptide first isolated from the skin of South American frogs. It binds as an agonist with high potency and selectivity to mu opioid receptors. Dermorphin is not found in humans or other mammals. It appears to be made in mammals through an unusual posttranslational modification carried out by an amino acid isomerase.</p>Fórmula:C40H50N8O10Pureza:Min. 95%Peso molecular:802.87 g/molH-His-Arg-OH trifluroacetate
CAS:<p>Please enquire for more information about H-His-Arg-OH trifluroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C12H21N7O3•(C2HF3O2)xPureza:Min. 95%Forma y color:PowderDAPTA
CAS:<p>Dapta is a basic protein that belongs to the group of long-chain polyamines. It is synthesized from the amino acid, putrescine and serves as a precursor for the synthesis of other polyamines. Dapta is also known to have biological properties such as long-term toxicity, neuronal death, and inhibition of cancer growth in mice. The polymerase chain reaction (PCR) technique has been used to show that dapta is expressed in atherosclerotic lesions and has a role in inflammatory responses. Dapta inhibits tumor necrosis factor-α (TNF-α) production through toll-like receptor 4 (TLR4), leading to reduced inflammation.</p>Fórmula:C35H56N10O15Pureza:Min. 95%Peso molecular:856.88 g/molFmoc-Val-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Val-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Mozavaptan
CAS:Producto controlado<p>Mozavaptan is a pharmacological agent that acts as a vasopressin V2 receptor antagonist. It is derived through synthetic chemical processes designed to target specific neurohormonal pathways in the body. Mozavaptan exerts its effects by inhibiting the action of vasopressin, a hormone that promotes water reabsorption in the kidneys. By blocking the vasopressin receptors, it enhances water excretion and corrects imbalances in electrolyte levels, particularly addressing conditions like hyponatremia.</p>Fórmula:C27H29N3O2Pureza:Min. 98 Area-%Forma y color:PowderPeso molecular:427.54 g/molAmyloid β-Protein (11-42) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (11-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C152H244N40O42SPureza:Min. 95%Peso molecular:3,335.87 g/molS-Sulfo-L-cysteine sodium
CAS:<p>S-sulfo-L-cysteine sodium is a high purity antibody that can be used as a research tool. It has been shown to interact with ion channels and protein interactions. S-sulfo-L-cysteine sodium is also used in the study of cell biology, pharmacology, and receptor binding. This substance is a ligand that activates or inhibits certain receptors, specifically peptides and ion channels. The CAS number for this molecule is 7381-67-1.</p>Fórmula:C3H6NNaO5S2Pureza:Min. 95%Peso molecular:223.2 g/molPKI-tide
CAS:<p>PKI-tide is a potent, selective inhibitor of the calcium/calmodulin-dependent protein kinase. It inhibits the activity of this enzyme and prevents the activation of other protein kinases by this enzyme. PKI-tide binds to the ATP site of the calcium/calmodulin-dependent protein kinase and blocks the binding of ATP and calmodulin. This inhibition prevents the phosphorylation of target proteins, including myosin light chain in muscle cells.</p>Fórmula:C85H149N31O24Pureza:Min. 95%Peso molecular:1,989.29 g/molH-Glu(Glu(Glu-OH)-OH)-OH trifluoroacetate salt
CAS:<p>H-Glu(Glu(Glu-OH)-OH)-OH trifluoroacetate salt is a casein that is used as a model system for pancreatic β-cells. It has been shown to induce cell apoptosis in malignant cells and sequences that are associated with the development of pancreatic cancer. H-Glu(Glu(Glu-OH)-OH)-OH trifluoroacetate salt also induces endothelial cell proliferation and decreases cell function, which may be due to its ability to promote uptake of this compound.</p>Fórmula:C15H23N3O10Pureza:Min. 95%Peso molecular:405.36 g/molBIBP 3226 trifluoroacetate
CAS:<p>Antagonist of neuropeptide receptor Y1</p>Fórmula:C27H31N5O3•CF3CO2HPureza:Min. 95%Forma y color:PowderPeso molecular:587.6 g/molBz-Nle-Lys-Arg-Arg-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Bz-Nle-Lys-Arg-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C41H60N12O7·C2HF3O2Pureza:Min. 95%Forma y color:White PowderPeso molecular:832.99 g/molZ-Phe-Val-OH
CAS:<p>Z-Phe-Val-OH is an optical isomer of the molecule Z-Val-OH. It can be synthesized from the reactants Isobutyl, Chloroformate, and Hydrophobic. This synthetic product has been shown to have high yields and specificities. The chiral center in this molecule causes it to rotate light in one direction or another, which means that it can be used to create a spectrum of colors. The synthesis of this molecule takes place in a kinetically controlled manner. When mixed with amines, carboxylic acids, and tripeptides, this compound will form a tripeptide bond with two amino acids on either side of the peptide chain.</p>Fórmula:C22H26N2O5Pureza:Min. 95%Peso molecular:398.45 g/molCIN16645
CAS:<p>CIN16645 is a peptide inhibitor of protein interactions. It has been shown to bind to the receptor and inhibit the activation of ion channels, which are proteins that form pores in cell membranes to allow ions to pass through. CIN16645 is a ligand for the receptor and can be used as a research tool for studying ion channels. The purity of this product is high, with no detectable impurities. This product is intended for use in life sciences research applications, such as antibody production and cell biology research.</p>Fórmula:C50H93NO9Pureza:Min. 95%Peso molecular:852.3 g/molNeurotensin (8-13), N-Acetyl
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C40H66N12O9Peso molecular:859.05 g/molUroguanylin Topoisomer B (human) trifluoroacetate salt
<p>Please enquire for more information about Uroguanylin Topoisomer B (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C64H102N18O26S4Pureza:Min. 95%Peso molecular:1,667.86 g/molN-(3-Amino-2-hydroxy-3-oxopropyl)-L-valyl-N-phenyl-L-leucinamide
CAS:<p>Please enquire for more information about N-(3-Amino-2-hydroxy-3-oxopropyl)-L-valyl-N-phenyl-L-leucinamide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C20H32N4O4Pureza:Min. 95%Forma y color:PowderPeso molecular:392.49 g/molMots-C acetate
CAS:<p>Mots-C acetate salt form</p>Fórmula:C101H152N28O22S2•(C2H4O2)3Pureza:Min. 95%Peso molecular:2,354.59 g/molPhenylalanine-free protein 115 120 125
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C85H131N21O26SPeso molecular:1,895.18 g/molCaspase 1 Substrate 1 (ICE), chromogenic
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C217H322N58O60SPeso molecular:4,767.47 g/molDynorphin A (3-8), porcine
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C35H60N12O7Peso molecular:760.94 g/molN-10 Region of TRAP
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C51H78N11O21SPeso molecular:1,213.32 g/molgp100 (619-627)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C49H82N14O14SPeso molecular:1,123.35 g/molProsaptide, wild type
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C72H127N19O25Peso molecular:1,658.93 g/mol[Tyr15]-ACTH (7-15)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C55H76N14O11Peso molecular:1,109.31 g/molβ-Amyloid (17-21)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C32H45N5O6Peso molecular:595.75 g/molQX 314
CAS:<p>QX 314 is a synthetic compound that is a potent and selective blocker of voltage-gated Na channels. It has been shown to activate neurons in the central nervous system, inducing locomotor activity, and also to inhibit cardiac contractility. QX 314 binds to the channel pore of voltage-gated Na channels, blocking their activation. The binding site on the channel is not specific for any one type of channel protein α subunit, but it does not bind to other proteins such as the NMDA receptor. This drug has been shown to be effective in treating diabetic neuropathy and bone cancer.</p>Pureza:Min. 95%Z-Ala-Arg-Arg-AMC hydrochloride salt
CAS:<p>Z-Ala-Arg-Arg-AMC hydrochloride salt is a synthetic amino acid that inhibits aminopeptidase activity. It is used to study the enzyme's role in the degradation of muscle proteins, and as a pharmaceutical drug for treating inflammatory bowel disease. The target enzyme is inhibited by binding to its active site, thereby preventing the breakdown of peptides. Z-Ala-Arg-Arg-AMC hydrochloride salt can be used as an inhibitor in the laboratory because it prevents denaturation of protein samples during analysis using electrophoresis or chromatography. This product also has been shown to have inhibitory effects on ileal aminopeptidases and prostate aminopeptidases, which may be due to its ability to bind to these enzymes and block their active sites.</p>Fórmula:C33H44N10O7•(HCl)xPureza:Min. 95%Peso molecular:692.77 g/mol(S)-Luliconazole
CAS:<p>(S)-Luliconazole is an antifungal agent that is synthesized from an imidazole compound. This compound is biphenyl in structure and is often derived through chiral synthesis techniques to isolate the (S)-enantiomer, which is the active form that enhances pharmacological effects. Its mode of action involves inhibiting the enzyme lanosterol 14α-demethylase, an essential component in fungal cell membrane synthesis. This inhibition disrupts the production of ergosterol, a critical sterol in fungal membranes, ultimately leading to increased membrane permeability and cell death.</p>Fórmula:C14H9Cl2N3S2Pureza:Min. 95%Peso molecular:354.3 g/molAc-(6-O-stearoyl)-muramyl-Ala-D-Glu-NH2
CAS:<p>Please enquire for more information about Ac-(6-O-stearoyl)-muramyl-Ala-D-Glu-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C37H66N4O12Pureza:Min. 95%Forma y color:White To Off-White SolidPeso molecular:758.94 g/mol(D-Arg2, Sar 4)-Dermorphin (1-4) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Arg2, Sar 4)-Dermorphin (1-4) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Peso molecular:555.63Amyloid β-Protein (1-42) hydrochloride salt
CAS:<p>Key subunit of extracellular plaques found in the brains of patients with Alzheimer's disease; Hydrochloride salt</p>Fórmula:C203H311N55O60SPureza:Min. 95%Peso molecular:4,514.04 g/molLys(Dabsyl)-(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770 (667-676)-Gln-Lucifer Yellow ammonium salt
CAS:<p>Please enquire for more information about Lys(Dabsyl)-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-676)-Gln-Lucifer Yellow ammonium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C89H122N24O31S3Pureza:Min. 95%Peso molecular:2,120.26 g/mol(Pyr 11)-Amyloid b-Protein (11-40)
CAS:<p>Please enquire for more information about (Pyr 11)-Amyloid b-Protein (11-40) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C143H226N38O39SPureza:Min. 95%Peso molecular:3,133.62 g/molPerfluorophenyl 19-(2,5-dioxo-2H-pyrrol-1(5H)-yl)-17-oxo-4,7,10,13-tetraoxa-16-azanonadecan-1-oate
CAS:<p>Perfluorophenyl 19-(2,5-dioxo-2H-pyrrol-1(5H)-yl)-17-oxo-4,7,10,13-tetraoxa-16-azanonadecan-1-oate is a synthetic compound, which is derived through a series of complex organic syntheses involving perfluorinated reagents. This compound is meticulously designed to incorporate both perfluorinated aromatic groups and a flexible, polyether-based linker. The mode of action for this compound primarily revolves around its unique chemical structure, which facilitates interactions at the molecular level that can be favorable for a variety of biochemical applications.</p>Fórmula:C24H27F5N2O9Pureza:Min. 95%Peso molecular:582.5 g/mol(Asn23)-Amyloid b-Protein (1-40)
CAS:<p>Please enquire for more information about (Asn23)-Amyloid b-Protein (1-40) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C194H296N54O57SPureza:Min. 95%Peso molecular:4,328.82 g/molFmoc-Val-Cys(Psi(Dmp,H)pro)-OH
CAS:<p>Please enquire for more information about Fmoc-Val-Cys(Psi(Dmp,H)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C32H34N2O7SPureza:Min. 95%Forma y color:PowderPeso molecular:590.69 g/mol1-(Fmoc-aminomethyl)-b-D-galacturonic acid
CAS:<p>Please enquire for more information about 1-(Fmoc-aminomethyl)-b-D-galacturonic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C22H23NO8Pureza:Min. 95%Peso molecular:429.42 g/molEpitalon acetate
CAS:Producto controlado<p>Epitalon acetate is a synthetic analog of melatonin. It has been shown to increase the lifespan of various animals, including mice, rats, and fish. Epitalon acetate also has the ability to regulate spontaneous activity in old age-matched controls by normalizing their physical activity levels. Epitalon acetate also inhibits replication of influenza virus particles in vitro. This compound also has the potential to be used as an optical imaging agent for death and constant markers. Epitalon acetate may have therapeutic applications for humans with leukemia or other cancers.</p>Fórmula:C16H26N4O11Pureza:Min. 95%Peso molecular:450.4 g/molP38 MAP Kinase Inhibitor IV
CAS:<p>Phenol,2,2'-sulfonylbis[3,4,6-trichloro] is a sulfate-containing compound that has been shown to stimulate the immune system and activate mitogen-activated protein kinases (MAPKs) in mosquitoes. The inclusion of this substance in vaccines may lead to increased immunity against various diseases. Phenol,2,2'-sulfonylbis[3,4,6-trichloro] has also been shown to reduce cancer cell proliferation by modulating antigen-presenting cells and inducing apoptosis in ovarian cancer cells. This substance can be used as a cost-effective alternative to dextran sulfate for generating pluripotent stem cells from adult cells and can also be used as a scalable process for generating pluripotent cells from human amniotic fluid.</p>Fórmula:C12H4Cl6O4SPureza:Min. 95%Peso molecular:456.94 g/molFmoc-Ile-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Ile-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Z-His(Bzl)-OH
CAS:<p>Please enquire for more information about Z-His(Bzl)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C21H21N3O4Pureza:Min. 95%Peso molecular:379.41 g/molHBsAg Mouse Monoclonal Antibody
<p>Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Dengue Virus Type 3 Envelope Antigen, Recombinant
<p>Please enquire for more information about Dengue Virus Type 3 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%For-Nle-Leu-Phe-Nle-Tyr-Lys-OH
CAS:<p>For-Nle-Leu-Phe-Nle-Tyr-Lys-OH is an amino acid sequence that is a proteolytic fragment of the erythrocyte membrane protein band 3. It has been shown to be able to inhibit the activity of cytosolic calcium and actin filament polymerization, as well as inhibiting apoptosis in human polymorphonuclear leukocytes (PMNL). This compound has been found to be effective in preventing uptake of bacteria by neutrophils, which may be due to its ability to alter the pH gradient across the membrane and increase intracellular calcium levels. For-Nle-Leu-Phe-Nle-Tyr-Lys-OH also inhibits diacylglycerol synthesis, which may contribute to its antiinflammatory effects.</p>Fórmula:C43H65N7O9Pureza:Min. 95%Peso molecular:824.02 g/molAc-Val-Arg-Pro-Arg-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Val-Arg-Pro-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C34H51N11O7•C2HF3O2Pureza:Min. 98 Area-%Forma y color:PowderPeso molecular:839.86 g/molH-Phe-Val-OH
CAS:<p>H-Phe-Val-OH, also known as humanized Val-Phe-His-Leu (VHL), is a monoclonal antibody that binds to the antigen epidermal growth factor (EGF). It has been shown to have diagnostic and therapeutic properties in vitro. This antibody is used in the diagnosis of cancer tissues and is able to identify carcinoma cell lines. Furthermore, it can be used to diagnose hepatitis C virus infection. H-Phe-Val-OH blocks the binding of EGF with its receptor on the surface of cells and prevents the proliferation of cancerous cells. It also inhibits cancer growth by reducing the synthesis of proteins such as epidermal growth factor and transforming growth factor alpha.</p>Fórmula:C14H20N2O3Pureza:Min. 98%Forma y color:PowderPeso molecular:264.32 g/molOctreotide trifluoroacetate salt (Dimer, Antiparallel) (
<p>Please enquire for more information about Octreotide trifluoroacetate salt (Dimer, Antiparallel) ( including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C98H132N20O20S4Pureza:Min. 95%Peso molecular:2,038.48 g/mol(Arg13)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Arg13)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C194H300N54O58SPureza:Min. 95%Peso molecular:4,348.85 g/molAmyloid Dan Protein (1-34) (reduced) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid Dan Protein (1-34) (reduced) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C185H270N48O51S2Pureza:Min. 95%Peso molecular:4,046.55 g/molc11 Bodipy 581/591
CAS:<p>C11 Bodipy 581/591 is an inhibitor used in cancer research to study the effects of protein kinase inhibitors on tumor cells. This fluorescent analog is used to track the activity of cyclin-dependent kinases, which are involved in cell cycle regulation and apoptosis. C11 Bodipy 581/591 has been shown to be effective at inhibiting the growth of human cancer cells and inducing apoptosis. It is also used as an anticancer agent in Chinese medicine. This inhibitor can be detected in urine samples, making it a valuable tool for non-invasive cancer diagnosis and monitoring. Overall, C11 Bodipy 581/591 is a promising compound for cancer research due to its potent inhibitory effects on cancer cell growth and proliferation.</p>Fórmula:C30H35BF2N2O2Pureza:Min. 95%Peso molecular:504.4 g/molACY-775
CAS:<p>ACY-775 is a molecule that inhibits the growth of cancer cells. It has potent inhibitory activity against epidermal growth factor (EGF) and has been shown to be effective in treating brain infarction in cell cultures. ACY-775 has also been shown to have antidepressant response in clinical studies, which may be due to its ability to block serotonin reuptake. This drug also inhibits acid formation and synaptic dysfunction, which may contribute to its effect on depression. ACY-775 binds to lysine residues on the HER2+ breast cancer cells and inhibits their growth.</p>Fórmula:C17H19FN4O2Pureza:Min. 95%Peso molecular:330.36 g/molAmyloid β-Protein (1-38) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (1-38) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C184H277N51O56SPureza:Min. 95%Peso molecular:4,131.54 g/molAmyloid β/A4 Protein Precursor770 (586-595) (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta/A4 Protein Precursor770 (586-595) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C47H73N11O16SPureza:Min. 95%Peso molecular:1,080.21 g/molGW 0742
CAS:<p>Peroxisome proliferator-activated receptor PPARβ/ÎŽ agonist</p>Fórmula:C21H17F4NO3S2Pureza:Min. 95%Peso molecular:471.49 g/molH-D-Ile-Phe-Lys-pNA trifluoroacetate salt
CAS:<p>Please enquire for more information about H-D-Ile-Phe-Lys-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C27H38N6O5Pureza:Min. 95%Peso molecular:526.63 g/molEndothelin-1 (human, bovine, dog, mouse, porcine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Endothelin-1 (human, bovine, dog, mouse, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C109H159N25O32S5·C2HF3O2Pureza:Min. 95%Peso molecular:2,605.93 g/molTaranabant
CAS:<p>Inverse agonist of cannabinoid receptor CB1R. Taranabant was studied for its effect on smoking cessation and inducing weight loss. Serious adverse effects associated with this compound prevented further development as a drug in the clinic.</p>Fórmula:C27H25ClF3N3O2Pureza:Min. 95%Forma y color:SolidPeso molecular:515.95 g/molBexagliflozin
CAS:<p>Bexagliflozin is a drug that is used to treat type II diabetes in adults. It helps to control blood sugar levels by inhibiting the enzyme DPP-IV and increasing insulin release from the pancreas. Bexagliflozin has been shown to be effective in lowering blood sugar levels in patients with chronic kidney disease and cancer, as well as those with a body mass index (BMI) of 30 or higher. This drug is an oral hypoglycaemic agent that can be used for diagnostic purposes. It has also been shown to be clinically effective for the treatment of diabetic nephropathy and diabetic retinopathy. The enantiomers of bexagliflozin can be differentiated according to their pharmacological properties, which may allow for more targeted therapy.</p>Fórmula:C24H29ClO7Pureza:Min. 95%Peso molecular:464.94 g/mol(Cys26)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Cys26)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C194H295N53O57S2Pureza:Min. 95%Peso molecular:4,345.87 g/mol(Nle 35)-Amyloid b-Protein (1-42) ammonium salt
CAS:<p>Please enquire for more information about (Nle 35)-Amyloid b-Protein (1-42) ammonium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C204H313N55O60Pureza:Min. 95%Peso molecular:4,496 g/molFmoc-Homoarg (Z)2-OH
CAS:<p>Please enquire for more information about Fmoc-Homoarg (Z)2-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C38H38N4O8Pureza:Min. 95%Peso molecular:678.73 g/moln-Decyltetraoxyethylene
CAS:<p>N-Decyltetraoxyethylene is a fatty acid that can be synthesized by reacting naphthalene with ethylene oxide. It is used as a surfactant in pharmaceutical preparations and has been shown to have affinity for ligands such as anionic and cationic surfactants, fatty acids, and model proteins. N-Decyltetraoxyethylene also has antiviral properties, binding to influenza virus particles. This compound has been shown to exhibit bronchiolitis obliterans when administered to animals in vivo. The particle size of this compound is too small for it to be used as a respiratory inhalant drug, but the high surface area of the molecule allows it to be used as a nasal or eye drug.</p>Fórmula:C18H38O5Pureza:Min. 95%Forma y color:Clear LiquidPeso molecular:334.49 g/molCalpain inhibitor XII
CAS:<p>Inhibitor of calpain, a calcium-dependent cysteine protease which is implicated in the calcium-mediated processes such as apoptosis and neuronal membrane excitability. Calpain inhibitor XII has antiviral properties as it can inhibit the main protease Mpro (3CLpro) from SARS-CoV-2 with IC50 of 0.45 μM.</p>Fórmula:C26H34N4O5Pureza:Min. 95%Forma y color:PowderPeso molecular:482.57 g/molAR-AO 14418
CAS:<p>Inhibitor of GSK3β kinase</p>Fórmula:C12H12N4O4SPureza:Min. 95%Forma y color:PowderPeso molecular:308.31 g/molTenecteplase
CAS:<p>Enecteplase is a 527 amino acid glycoprotein developed by introducing the following 3 modifications to the complementary DNA for natural human tPA: a substitution of threonine 103 with asparagine, and a substitution of asparagine 117 with glutamine, both within the kringle 1 domain, and a tetra-alanine substitution at amino acids 296–299 in the protease domain. It binds to the fibrin component of the blood clot (thrombus) and selectively converts thrombus-bound plasminogen to plasmin, which degrades the fibrin matrix of the thrombus.</p>Pureza:(Sds-Page) Min. 95%VU0453379
CAS:<p>VU0453379 is a chemical compound that functions as a positive allosteric modulator (PAM) of the M4 muscarinic acetylcholine receptor. It is synthetically derived through medicinal chemistry processes designed to selectively enhance receptor signaling pathways. VU0453379 acts by binding to an allosteric site on the M4 receptor, distinct from the orthosteric site where endogenous neurotransmitters bind. This binding potentiates receptor sensitivity and activity in response to acetylcholine, thereby amplifying receptor-mediated signaling pathways.</p>Fórmula:C26H34N4O2Pureza:Min. 95%Peso molecular:434.6 g/molZ-Ile-Leu-aldehyde
CAS:<p>Please enquire for more information about Z-Ile-Leu-aldehyde including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C20H30N2O4Pureza:Min. 95%Peso molecular:362.46 g/molTrodusquemine
CAS:<p>Inhibitor of protein tyrosine phosphatase PTP1B</p>Fórmula:C37H72N4O5SPureza:Min. 95%Peso molecular:685.06 g/molBremelanotide
CAS:<p>Bremelanotide is a synthetic cyclic peptide, classified as a melanocortin receptor agonist. It is derived from the analogs of the alpha-melanocyte-stimulating hormone (α-MSH), with its origins in melanocortin system research. This product acts primarily through the activation of melanocortin 4 receptor (MC4R) pathways in the central nervous system.Bremelanotide exerts its physiological effects by stimulating these receptors, leading to increased neural signals related to sexual arousal and desire. The melanocortin receptors, especially MC4R, play a significant role in modulating various neural networks involved in sexual function.This compound is utilized primarily for the treatment of hypoactive sexual desire disorder (HSDD) in premenopausal women. By enhancing sexual desire and arousal, Bremelanotide provides a therapeutic option for individuals experiencing clinically significant distress related to low sexual desire. Its application in clinical settings highlights the potential of melanocortin pathways as therapeutic targets beyond their established roles in pigmentary and energy balance modulation.</p>Fórmula:C50H68N14O10Pureza:Min. 95%Forma y color:White PowderPeso molecular:1,025.16 g/mol1,2-Distearoyl-rac-glycero-3-phosphocholine
CAS:<p>1,2-Distearoyl-rac-glycero-3-phosphocholine is a synthetic phospholipid, which is typically derived from the hydrogenation of naturally occurring lecithins. This compound serves as a key structural component in lipid bilayers, joining polar heads with hydrophobic tails to form stable membranes.</p>Fórmula:C44H88NO8PPureza:Min. 95%Peso molecular:790.15 g/molH-Thr-Asp-OH TFA salt
CAS:<p>Please enquire for more information about H-Thr-Asp-OH TFA salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C8H14N2O6C2F3HO2Pureza:Min. 95%Peso molecular:348.23 g/molAmyloid b-Protein (1-40) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid b-Protein (1-40) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C194H296N54O57SPureza:Min. 95%Peso molecular:4,328.82 g/molRecombinant Measles virus Hemagglutinin glycoprotein(H)
<p>Please enquire for more information about Recombinant Measles virus Hemagglutinin glycoprotein(H) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:> 85%Z-Ile-Trp-OH
CAS:<p>Please enquire for more information about Z-Ile-Trp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C25H29N3O5Pureza:Min. 95%Peso molecular:451.51 g/molSB-423562
CAS:<p>SB-423562 is a synthetic compound, which is developed as a small molecule inhibitor, produced through chemical synthesis in a laboratory setting. Its mode of action involves selectively interfering with a specific biological pathway by binding to its target protein, thereby inhibiting its activity. This targeted action allows for precise modulation of signaling pathways, which can be pivotal in therapeutic interventions.</p>Fórmula:C26H32N2O4Pureza:Min. 95%Forma y color:PowderPeso molecular:436.54 g/molPeptide M
CAS:<p>Peptide M is a synthetic peptide made up of the amino acid sequence: DTNLASSTIIKEGIDKTV. It is an immunogenic component corresponding to amino acids 303-320 of the photoreceptor cell protein, retinal S-antigen. During studies, it has been found to induce experimental autoimmune uveitis (EAU) in animals which is a T-cell mediated disease causing retina, pineal gland and uveal tract inflammation. EAU successfully models ocular autoimmune diseases such as birdshot retinochoroidopathy and sympathetic ophthalmia. Therefore peptide M can be used in research into these diseases.<br>Structural studies have demonstrated peptide M to form macromolecular assemblies and then an intermolecular beta-sheet structure between a pH range of 4-9.5. It has been suggested, that when the peptide M adopts the monomeric state its structure and beta sheets become disordered. It is also thought that through its extended beta-type conformation peptide M is able to position itself between the major histocompatibility complex and the T-cell receptor.</p>Fórmula:C81H141N21O31Pureza:Min. 95%Peso molecular:1,905.11 g/molBifluranolum
CAS:<p>Bifluranolum is a synthetic nonsteroidal antiandrogen, which is synthesized in laboratory settings and not derived from natural sources. Its mode of action involves competitive inhibition of androgen receptors. By occupying these receptor sites, Bifluranolum inhibits the binding of endogenous androgens, effectively blocking their physiological actions. This property makes it a valuable tool in studies related to androgen-dependent biological processes.</p>Fórmula:C17H18F2O2Pureza:Min. 95%Peso molecular:292.32 g/molVX 702
CAS:<p>p38 MAP kinase antagonist</p>Fórmula:C19H12F4N4O2Pureza:Min. 95%Forma y color:SolidPeso molecular:404.32 g/molH-Asp-Ala-OH
CAS:<p>Adriamycin is an anticancer drug that is a structural analogue of aspartic acid. It can be synthesized in a solid-phase synthesis using a polymeric resin with an acidic functional group, such as H-Asp-Ala-OH. Adriamycin inhibits the production of inflammatory cytokines and prostaglandins, which are involved in the development of inflammatory diseases. Adriamycin has been shown to have anti-inflammatory effects on human serum and to inhibit the production of proteins important for tumor cell proliferation. Adriamycin also has anti-inflammatory properties due to its ability to bind with hydrogen bonds to acidic residues on proteins.<br>END></p>Fórmula:C7H12N2O5Pureza:Min. 98 Area-%Forma y color:PowderPeso molecular:204.18 g/molAuristatin E
CAS:<p>Auristatin E is a synthetic analog that functions as a potent microtubule-disrupting agent, derived from dolastatin 10, a natural product isolated from marine organisms. It acts by inhibiting microtubule dynamics, leading to cell cycle arrest and subsequent apoptosis in tumor cells. This mechanism disrupts crucial cellular processes, particularly in rapidly dividing cancer cells.</p>Fórmula:C40H69N5O7Pureza:Min. 95%Peso molecular:732.01 g/molBudralazine
CAS:<p>Budralazine is a synthetic vasodilator, which is derived from a series of hydrazine analogs, known for their ability to modulate vascular tone. Its mode of action involves the direct relaxation of vascular smooth muscle. This relaxation leads to a decrease in peripheral vascular resistance and, consequently, a reduction in blood pressure. Intriguingly, Budralazine is thought to selectively target arterioles over veins, making it of particular interest in the study of vascular dynamics and hypertension.</p>Fórmula:C14H16N4Pureza:Min. 95%Peso molecular:240.3 g/molAc-Ser-Asp-Lys-Pro-OH
CAS:<p>Ac-Ser-Asp-Lys-Pro-OH is a tetrapeptide that has been shown to stimulate the growth of cells in vitro. It has been found to inhibit the production of interleukin-1β and tumor necrosis factor α, which are cytokines that are involved in inflammation. Ac-Ser-Asp-Lys-Pro-OH stimulates the production of growth factor β1 and collagen, which may be due to its ability to bind to toll like receptor 4 (TLR4). Acetylserotonin has been shown to have antiinflammatory and antifibrotic properties in animal models. Acetylserotonin also inhibits cancer cell growth and reduces drug resistance.</p>Fórmula:C20H33N5O9Pureza:Min. 95%Peso molecular:487.5 g/molH-Ile-Ala-OH
CAS:<p>H-Ile-Ala-OH is a high quality product that has been extensively validated for its stability and effectiveness. It is a zymogen that has been shown to be active against pancreatic enzymes. H-Ile-Ala-OH binds to the hydrophobic region of the enzyme, which may be due to hydrogen bonding. The diameter of this molecule is 8.3 Ångströms, which allows it to bind to the enzyme's active site. H-Ile-Ala-OH has been shown to have prognostic value in cancer patients and can be used as a profile marker in porcine cells.</p>Fórmula:C9H18N2O3Pureza:Min. 95%Peso molecular:202.25 g/molZ-Ile-Val-OH
CAS:<p>Please enquire for more information about Z-Ile-Val-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C19H28N2O5Pureza:Min. 95%Peso molecular:364.44 g/molWM 1119
CAS:<p>Selective and potent inhibitor of lysine acetyltransferases KAT6A and KAT6B with IC50 values in low nanomolar range. The compound is a reversible competitor of acetyl coenzyme A domain of KAT6A/B enzymes. It inhibits MYST-catalysed histone acetylation and was shown to arrest lymphoma progression in mice models. The compound opened the door to a new class of cancer therapeutics that could potentially direct the cancer cells in senescence or permanent dormancy.</p>Fórmula:C18H13F2N3O3SPureza:Min. 95%Forma y color:White/Off-White SolidPeso molecular:389.38 g/molFmoc-Ser(tBu)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Ser(tBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%ACY 1215
CAS:<p>Rocilinostat (ACY-1215) is an orally bioavailable, specific inhibitor of histone deacetylase 6 (HDAC6) with potential antineoplastic activity.</p>Fórmula:C24H27N5O3Pureza:Min. 95%Peso molecular:433.5 g/molgp100 (570-579)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C41H71N11O17Peso molecular:990.09 g/molInfluenza NP (50-57)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C41H65N11O15Peso molecular:952.04 g/molZ-Ile-Pro-OH
CAS:<p>Z-Ile-Pro-OH is an experimental inhibitor of protein synthesis that has been shown to inhibit collagenase and pancreatic proteases. Z-Ile-Pro-OH inhibits the second order rate constant of hydrolysis by a kinetic method. The pH optimum of Z-Ile-Pro-OH is 7.5 and it does not hydrolyze at this pH. Z-Ile-Pro-OH binds to the active site of the protease, inhibiting its activity and has been shown to be non toxic in mice. The synthetic inhibitor has been used as a nutritional supplement for humans because it does not affect the pancreas or liver when ingested orally, but has no effect on bone growth.</p>Fórmula:C19H26N2O5Pureza:Min. 95%Peso molecular:362.42 g/molFMRF-related peptide, Lymnaea heptapeptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C41H59N11O9Peso molecular:850.00 g/molH-Ile-Pro-OH
CAS:<p>H-Ile-Pro-OH is an amino acid that is a constituent of sphingolipids, which are important for the metabolism of lipids and other biological substances. H-Ile-Pro-OH can be found in casein as well as oxidation products of casein. It has been used in diagnostic tests to measure levels of hippuric acid in plasma samples. The dietary intake of H-Ile-Pro-OH can be determined by measuring the concentration of this amino acid in plasma samples. Synthetic H-Ile-Pro-OH can also be used for studies on the metabolism of tryptophan. This amino acid has been shown to inhibit chloride ion transport across the cell membrane and fatty acid synthesis, as well as proteolysis and protein degradation by pancreatic enzymes.</p>Fórmula:C11H20N2O3Pureza:Min. 95%Peso molecular:228.29 g/molAtorvastatin acid
CAS:<p>Atorvastatin acid is a pharmaceutical compound belonging to the class of statins, which is a synthetic derivative of fungal metabolites. It functions as an HMG-CoA reductase inhibitor, playing a critical role in the cholesterol biosynthesis pathway. By inhibiting this key enzyme, atorvastatin acid effectively reduces the conversion of HMG-CoA to mevalonate, a precursor of cholesterol, thus lowering overall cholesterol levels in the bloodstream.</p>Fórmula:C33H35FN2O5Pureza:Min. 98 Area-%Forma y color:White PowderPeso molecular:558.64 g/molSartorypyrone D
CAS:<p>Sartorypyrone is active against the Gram-positive bacteria B. subtilis, K. rhizophila, and M. smegmatis</p>Fórmula:C26H38O4Pureza:Min. 95%Peso molecular:414.6 g/molFluorescein-6-carbonyl-Val-Asp(OMe)-Val-Ala-DL-Asp(OMe)-fluoromethylketone
CAS:<p>Please enquire for more information about Fluorescein-6-carbonyl-Val-Asp(OMe)-Val-Ala-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C45H50FN5O15Pureza:Min. 95%Peso molecular:919.9 g/mol(Phenylac 1,D-Tyr(Me)2,Arg6·8,Tyr-NH29)-Vasopressin trifluoroacetate salt Phenylac-D-Tyr(Me)-Phe-Gln-Asn-Arg-Pro-Arg-Tyr-NH2 tri
CAS:<p>Please enquire for more information about (Phenylac 1,D-Tyr(Me)2,Arg6·8,Tyr-NH29)-Vasopressin trifluoroacetate salt Phenylac-D-Tyr(Me)-Phe-Gln-Asn-Arg-Pro-Arg-Tyr-NH2 tri including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C62H83N17O13Pureza:Min. 95%Forma y color:PowderPeso molecular:1,274.43 g/molUrolithin M7
CAS:<p>Urolithin M7 is a metabolite, which is derived from the transformation of ellagitannins, compounds found predominantly in pomegranates, berries, and nuts. This transformation occurs via intestinal microbiota, which convert ellagitannins into various urolithins, including Urolithin M7. Its mode of action involves influencing cellular processes, potentially modulating mitochondrial function and autophagy pathways. The action mechanisms are being explored for their roles in enhancing cell viability and metabolic health.</p>Fórmula:C13H8O5Pureza:Min. 95%Peso molecular:244.2 g/molAR-13324 mesylate
CAS:<p>AR-13324 mesylate is a pharmaceutical compound, which is a selective Rho kinase inhibitor derived from chemical synthesis with a specific mode of action targeting the modulation of aqueous humor outflow in the eye. Structurally, it is designed to inhibit the Rho-associated protein kinase (ROCK) pathway, which plays a crucial role in controlling various cellular functions including contraction, motility, proliferation, and apoptosis, specifically affecting the trabecular meshwork and uveoscleral pathway in ocular tissues.</p>Fórmula:C29H31N3O6SPureza:Min. 95%Peso molecular:549.64 g/mol9-cis-Retinoic acid
CAS:Producto controlado<p>A natural metabolite of vitamin A. It is derived from all-trans retinoic acid, FR17921. It potently activates all isoforms of retinoic acid receptor (RAR) as well as retinoid X receptor (RXR) isoforms.</p>Fórmula:C20H28O2Pureza:Min. 95%Forma y color:PowderPeso molecular:300.44 g/molZ-Glu-Leu-OH·DCHA
CAS:Producto controlado<p>Please enquire for more information about Z-Glu-Leu-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C19H26N2O7·C12H23NPureza:Min. 95%Peso molecular:575.74 g/molBoc-Gly-Arg-OH
CAS:<p>Please enquire for more information about Boc-Gly-Arg-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C13H25N5O5Pureza:Min. 95%Peso molecular:331.37 g/molFmoc-Asp(OtBu)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Asp(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Cyclo(-Arg-Gly-Asp-D-Phe-Val) trifluoroacetate salt
CAS:<p>Cyclo(-Arg-Gly-Asp-D-Phe-Val) trifluoroacetate salt is a basic fibroblast growth factor that has been shown to have proliferative effects on diabetic retinopathy and ocular neovascularization. It binds to integrin receptors on the surface of cells, which are involved in cell adhesion. Cyclo(-Arg-Gly-Asp-D-Phe-Val) trifluoroacetate salt also has antiangiogenic effects and blocks the angiogenesis process by inhibiting the production of epidermal growth factor (EGF). This drug may be useful for treating certain types of cancer such as malignant brain tumors or neuroblastomas, because it can cause neuronal death. Cyclo(-Arg-Gly-Asp-D-Phe-Val) trifluoroacetate salt is a cyclic peptide with a reactive amino acid side chain.</p>Fórmula:C26H38N8O7Pureza:Min. 95%Peso molecular:574.63 g/molZ-Asp-Gln-Met-Asp-AFC
CAS:<p>Please enquire for more information about Z-Asp-Gln-Met-Asp-AFC including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C36H39F3N6O13SPureza:Min. 95%Peso molecular:852.79 g/molFelodipine
CAS:<p>L-type calcium channel blocker; anti-hypertensive</p>Fórmula:C18H19Cl2NO4Pureza:Min. 95%Forma y color:White PowderPeso molecular:384.25 g/molNocistatin (Bovine)
CAS:<p>Nocistatin is a research tool that can be used in the study of protein interactions. It is a synthetic peptide that binds to receptor sites on cell membranes, which has been shown to inhibit ion channels and receptor-mediated signal transduction. Nocistatin (Bovine) has been shown to inhibit calcium ion channel activity and membrane depolarization by binding to the alpha1 subunit of GABA A receptors.</p>Fórmula:C82H135N21O32Pureza:Min. 95%Peso molecular:1,927.1 g/molEntacapone
CAS:Producto controlado<p>Catechol-O-methyltransferase inhibitor</p>Fórmula:C14H15N3O5Pureza:Min. 98 Area-%Forma y color:Yellow PowderPeso molecular:305.29 g/mol(±)-Carazolol-d7
CAS:<p>(±)-Carazolol-d7 is a deuterated beta-adrenergic receptor antagonist, often used for pharmacological and biochemical studies. This isotopically labeled compound is a synthetic derivative of carazolol, sourced through precise deuterium exchange techniques designed to ensure high isotopic purity.</p>Fórmula:C18H22N2O2Pureza:Min. 95%Peso molecular:305.4 g/molSaposin C18
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C93H164N24O31Peso molecular:2,114.49 g/molBRD6688
CAS:<p>BRD6688 is a protein inhibitor that binds to and inhibits the activity of GABA transporters. It is a potent inhibitor of the gaba transporter (GAT) with an IC50 of 0.2 μM. BRD6688 has been shown to inhibit the acetylation of histone proteins, which are important for transcriptional regulation and gene expression. BRD6688 also has a thermodynamic inhibitory constant (Ki) of 1.4 μM and a kinetic inhibitory constant (Ki) of 0.3 μM, indicating that it binds tightly to GATs and does not dissociate easily from it. The Ki values were determined by measuring the inhibition of GAT-mediated chloride transport in cells cultured in vitro. This drug also inhibits antigen presentation in T cells by inhibiting protein synthesis and cell division, as well as histone methylation during mitosis, leading to downregulation of cell-surface antigens on B cells.</p>Fórmula:C16H18N4OPureza:Min. 95%Forma y color:PowderPeso molecular:282.34 g/molOctreotide trifluoroacetate salt (Dimer, Parallel) (
<p>Please enquire for more information about Octreotide trifluoroacetate salt (Dimer, Parallel) ( including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C98H132N20O20S4Pureza:Min. 95%Peso molecular:2,038.48 g/molCeratotoxin B
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C135H235N35O32Peso molecular:2,860.59 g/molAlternate Syntide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C63H112N18O19Peso molecular:1,425.70 g/mol[Gln11]-β-Amyloid (1-40)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C194H296N54O57SPeso molecular:4,328.91 g/molAnaplasma Phagocytophilum Surface Protein AipA, Recombinant
<p>Please enquire for more information about Anaplasma Phagocytophilum Surface Protein AipA, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%PRI-724
CAS:<p>PRI-724 is an investigational small molecule known as a selective inhibitor of the Wnt/β-catenin signaling pathway. It is derived from extensive research into targeting dysregulated cellular pathways implicated in oncogenesis. PRI-724 operates by binding to the transcriptional co-activator CBP, thereby disrupting the interaction between CBP and β-catenin, which is crucial for the transcription of genes involved in cell proliferation and survival.</p>Fórmula:C33H35N6O7PPureza:Min. 95%Peso molecular:658.6 g/molTyrosinase (243-251) (human) acetate salt
CAS:<p>H-KCDICTDEY-OH peptide, corresponding to amino acids 243-251 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>Fórmula:C44H68N10O18S2Pureza:Min. 95%Peso molecular:1,089.2 g/molProtein Kinase P34 (cd2) Substrate trifluoroacetate salt
CAS:<p>H-ADAQHATPPKKKRKVEDPKDF-OH peptide, which can act as a substrate of Protein Kinase P34 (cd2). The peptide is supplied as a trifluoroacetate salt.</p>Fórmula:C106H172N32O32Pureza:Min. 95%Peso molecular:2,406.7 g/molTyrosinase (206-214) (human) acetate salt
CAS:<p>H-AFLPWHRLF-OH peptide, corresponding to amino acids 206-214 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>Fórmula:C61H83N15O10Pureza:Min. 95%Peso molecular:1,186.41 g/molTyrosinase (192-200) (human, mouse) acetate salt
CAS:<p>H-SEIWRDIDF-OH peptide, corresponding to amino acids 192-200 of human and mouse Tyrosinase. The peptide is supplied as an acetate salt.</p>Fórmula:C54H77N13O17Peso molecular:1,180.27 g/molMyosin Light Chain Kinase (480-501)
CAS:<p>H-AKKLSKDRMKKYMARRKWQKTG-NH2 peptide, corresponding to 480-501 amnino acids of Myosin Light Chain Kinase. Myosin Light Chain Kinase is a serine/threonine specific protein kinase that phosphorylates the myosin light chain.</p>Fórmula:C120H209N41O28S2Pureza:Min. 95%Peso molecular:2,738.34 g/mol(Val438)-Tyrosinase (432-444) (human) acetate salt
CAS:<p>H-SYLQDSVPDSFQD-OH peptide, corresponding to amino acids 432-444 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>Fórmula:C65H93N15O26Pureza:Min. 95%Peso molecular:1,500.52 g/molFMRF-related peptide, SDPFLRF-NH2
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C42H61N11O10Peso molecular:880.02 g/molKGF Receptor Peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C114H174N30O42SPeso molecular:2,668.90 g/molEhrlichia Canis gp19 Antigen, Recombinant
<p>Please enquire for more information about Ehrlichia Canis gp19 Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%GRF (human) acetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Fórmula:C215H358N72O66SPureza:Min. 98 Area-%Forma y color:PowderPeso molecular:5,039.65 g/molCys-Gly-Lys-Lys-Gly-Amyloid β-Protein (33-40)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C51H92N15O14S2Peso molecular:1,203.52 g/molPalmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-Ser-Lys-Lys-Lys-Lys-OH trifluoroacetate salt
CAS:<p>Agonist of toll-like receptors TLR1/2</p>Fórmula:C81H156N10O13SPureza:Min. 95%Peso molecular:1,510.23 g/molDABCYL-TNF-α-EDANS (-4 to +6) (human) trifluoroacetate salt
CAS:<p>DABCYL-TNF-alpha-EDANS (-4 to +6) (human) trifluoroacetate salt is a fine chemical that has been shown to be useful in research. It is a versatile building block for the synthesis of complex compounds and can be used as a reaction component for the synthesis of speciality chemicals. The compound is a high quality reagent, which can be used as an intermediate for the synthesis of other chemical compounds.</p>Fórmula:C70H104N22O18S·C2HF3O2Pureza:Min. 95%Forma y color:Red SolidPeso molecular:1,687.8 g/molTNF-α (72-82), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C48H86N18O16Peso molecular:1,171.33 g/molCorazonin, American Cockroach, Periplaneta americana
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C62H86N18O19Peso molecular:1,369.49 g/mol((R)-4-Hydroxy-4-methyl-Orn7)-phalloidin
CAS:<p>Please enquire for more information about ((R)-4-Hydroxy-4-methyl-Orn7)-phalloidin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C35H49N9O10SPureza:Min. 95%Forma y color:PowderPeso molecular:787.88 g/mol[D-Tyr27,36, D-Thr32]-Neuropeptide Y, human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C189H285N55O57SPeso molecular:4,271.67 g/molBradykinin Potentiator B
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C56H91N15O13Peso molecular:1,182.46 g/molβ-Amyloid (10-35)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C133H204N34O37SPeso molecular:2,903.38 g/mol[Ala8]-Humanin, [Ala8]-HN, Shna
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C119H204N34O32SPeso molecular:2,655.23 g/molBiotin-Intermedin (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C229H353N71O68S4Peso molecular:5,329.14 g/molp5 Ligand for Dnak and and DnaJ
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C44H81N15O11SPeso molecular:1,028.29 g/molBand 3 Protein (547-553) (human)
CAS:<p>Please enquire for more information about Band 3 Protein (547-553) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C41H63N11O11Peso molecular:886.02 g/mol(Cys39)-Tissue Factor (33-53)
CAS:<p>Please enquire for more information about (Cys39)-Tissue Factor (33-53) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C111H166N26O33S2Pureza:Min. 95%Peso molecular:2,456.79 g/molCopeptin (rat) trifluoroacetate salt
CAS:<p>Copeptin (rat) trifluoroacetate salt is a peptide that belongs to the group of protein inhibitors. It can inhibit the activity of the acetylcholine receptor, which leads to an increase in muscle tone and rigidity. Copeptin is also used as a research tool for studying protein interactions, antibody-antigen reactions, cell biology, ligand-receptor binding, pharmacology and life sciences. Copeptin has been shown to inhibit ion channels such as nicotinic receptors and potassium channels. The CAS number for copeptin (rat) trifluoroacetate salt is 86280-64-0.</p>Fórmula:C183H307N57O61Pureza:Min. 95%Peso molecular:4,281.74 g/molH-Ile-Met-OH
CAS:<p>H-Ile-Met-OH is a cytosolic protein that is found in the cytosolic domain of plant cells. H-Ile-Met-OH is an enzyme that catalyzes the conversion of HMBP to Met, which is an intermediate in the biosynthesis of methionine. The frequency and sequence of H-Ile-Met-OH has been analyzed in animals, plants, and fungi. Bioinformatics studies have shown that H-Ile-Met-OH has a vacuolar function, which can be seen by its sequence similarity to other vacuolar proteins.</p>Fórmula:C11H22N2O3SPureza:Min. 95%Peso molecular:262.37 g/molBoc-Lys(Tfa)-AMC
CAS:<p>Boc-Lys(Tfa)-AMC is a small molecule that inhibits the acetylation of histone H3 and has anticancer activity. Acetylation increases the rate of transcription and replication, whereas Boc-Lys(Tfa)-AMC inhibits this process by preventing acetylation. This drug also binds to δ-opioid receptors in cancer cells, triggering a redox signal that leads to inhibition of cancer cell proliferation. The mechanism of this drug's anticancer activity is unknown, but it may be due to its ability to inhibit enzyme activities or disulfide bond formation in vivo.</p>Fórmula:C23H28F3N3O6Pureza:Min. 95%Peso molecular:499.48 g/molGhrelin-[Cys(AF647)] Human
<p>Ghrelin is a peptide hormone mainly produced in the stomach. Ghrelin is involved in several physiological processes, including feeding, lipid accumulation, stress response- anxiety- cardiac performance- immunity and inflammation, taste sensation, reward-seeking behaviour, glucose metabolism and thermogenesis, memory, motivation and learning.Ghrelin exerts its actions by binding the growth hormone secretagogue receptor (GHSR), mainly found in the hypothalamic and mesolimbic brain regions and peripheral organs (adipose tissue, adrenals, and stomach).Ghrelin is produced by the cleavage of the precursor peptide preproghrelin. The attachment of a fatty acid to its serine 3 residue makes a form capable of activating GHSR.Ghrelin is a valuable target for treating conditions such as anorexia, cachexia, sarcopenia, cardiopathy, neurodegenerative disorders, renal and pulmonary disease, gastrointestinal disorders, inflammatory disorders and metabolic syndrome.This ghrelin has a C-terminal AF647, a structural analog to Alexa Fluor 647, a widely used far-red fluorescent dye. Its excitation is ideally suited to 594nm or 633nm. This dye is suited for low abundance targets as it has high initial brightness and a high photostability allowing detection of low abundance peptides.</p>Pureza:Min. 95%Peso molecular:4,326.9 g/molhCG protein
<p>The hCG protein is a growth factor that plays a crucial role in various biological processes. It is involved in the regulation of cell growth, differentiation, and development. This protein has been extensively studied in the field of Life Sciences and has shown promising results in various applications. One of the key characteristics of the hCG protein is its ability to interact with arginase, an enzyme involved in the metabolism of arginine. Through molecular docking studies, it has been shown that hCG can bind to arginase and modulate its activity, leading to potential therapeutic applications. Monoclonal antibodies targeting the hCG protein have been developed for research purposes. These antibodies are highly specific and can be used in immunoassays to detect and quantify hCG levels in human serum samples. They have also been used for the immobilization of hCG on electrodes, enabling the development of biosensors for diagnostic purposes. Furthermore, studies have demonstrated that the hCG protein plays a role in the regulation of mes</p>Pureza:Min. 95%H-Val-Val-Val-OH trifluroacetate
CAS:<p>Please enquire for more information about H-Val-Val-Val-OH trifluroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C15H29N3O4•(C2HF3O2)xPureza:Min. 95%H-ASCLYGQLPK-OH
<p>Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Fórmula:C48H76N12O13SPeso molecular:1,079.27 g/molLY 117018
CAS:<p>LY 117018 is a dopamine analog that binds to the toll-like receptor and blocks the production of proinflammatory cytokines. LY 117018 also inhibits epidermal growth factor (EGF) in liver cells and cyclin D2, which is involved in cell cycle regulation. This drug has been shown to be effective in a model system using fetal bovine serum with angiogenic factors, such as vascular endothelial growth factor (VEGF). The effect on blood vessels was dose-dependent for LY 117018. This drug potentiates the actions of 17β-estradiol on mcf-7 cells and serum prolactin levels are significantly decreased in vivo by this compound.</p>Fórmula:C27H25NO4SPureza:Min. 95%Peso molecular:459.6 g/molAptiganel
CAS:<p>Aptiganel (CAS No. 137159-92-3) is a research tool that can be used to study the interaction of proteins and peptides with ion channels. It is an inhibitor of ion channels that blocks the flow of ions through them, thereby preventing the generation of action potentials. Aptiganel is a potent inhibitor of voltage-dependent calcium channels, which are found in neurons and muscle cells. This drug binds to ligands on the extracellular side of ion channel receptors and prevents ligand binding to the receptor, blocking ion flow. Aptiganel has been shown to inhibit voltage-gated potassium channels in rat dorsal root ganglion cells, human neuroblastoma cells grown in culture, and cultured mouse embryo spinal cord neurons. Aptiganel also inhibits voltage-gated sodium channels in rat dorsal root ganglion cells and cultured mouse embryo spinal cord neurons.</p>Fórmula:C20H21N3Pureza:Min. 95%Peso molecular:303.4 g/molNalmefene
CAS:Producto controlado<p>μ- and κ- opioid receptor antagonist; partial agonist of δ- opioid receptors</p>Fórmula:C21H25NO3Pureza:Min. 95%Peso molecular:339.43 g/molH-Glu-Gly-Arg-chloromethylketone trifluoroacetate salt
CAS:<p>H-Glu-Gly-Arg-chloromethylketone trifluoroacetate salt is an anticoagulant drug that prevents the formation of blood clots by inhibiting the enzyme thrombin. This drug is effective in enhancing blood flow and oxygen supply to the heart and other organs. H-Glu-Gly-Arg-chloromethylketone trifluoroacetate salt has been shown to have a positive effect on patients with congestive heart failure. It has also been used as an adjuvant therapy in bypassing procedures, where clotting occurs at the site of an artificial conduit placed in the body to allow blood flow between two points. In vitro studies have demonstrated that this drug inhibits protease activity, which may be due to its ability to inhibit fibrinogen and serine protease activity.</p>Fórmula:C14H25ClN6O5Pureza:Min. 95%Peso molecular:392.84 g/molH-Ala-Ala-Ala-OH trifluroacetate
CAS:<p>Please enquire for more information about H-Ala-Ala-Ala-OH trifluroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C9H17N3O4•(C2HF3O2)xPureza:Min. 95%H-Gly-Leu-Gly-OH trifluroacetate
CAS:<p>Please enquire for more information about H-Gly-Leu-Gly-OH trifluroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C10H19N3O4•C2HF3O2Pureza:Min. 95%Peso molecular:359.3 g/molH-Leu-Leu-Gly-OH trifluroacetate
CAS:<p>Please enquire for more information about H-Leu-Leu-Gly-OH trifluroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C14H27N3O4•C2HF3O2Pureza:Min. 95%Peso molecular:415.4 g/mol
![[D-Arg1,D-Phe5,D-Trp7,11]-Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00151.webp&w=3840&q=75)
![[Phe1376]-Fibronectin Fragment (1371-1382)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00679.webp&w=3840&q=75)
![[Leu144,Arg147]-Myelin Proteolipid Protein(139-151)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00722.webp&w=3840&q=75)
![N-[(2RS,3RS)-2,3,4-Trihydroxy-butyl]-Val-Leu-anilide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFT108329.webp&w=3840&q=75)
![[Tyr15]-ACTH (7-15)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00398.webp&w=3840&q=75)
![[Gln11]-β-Amyloid (1-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00314.webp&w=3840&q=75)
![[D-Tyr27,36, D-Thr32]-Neuropeptide Y, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00911.webp&w=3840&q=75)
![[Ala8]-Humanin, [Ala8]-HN, Shna](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00593.webp&w=3840&q=75)
![Ghrelin-[Cys(AF647)] Human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1110382.webp&w=3840&q=75)
