Compuestos y reactivos bioquímicos

<p>Haloperidol antibody was raised in rabbit using haloperidol-KLH as the immunogen.</p>

<p>Mouse monoclonal CD8 antibody (biotin)</p>

<p>Purified recombinant HTLV1 gp21 protein</p>

<p>Mouse monoclonal HIV1 gp120 protein (biotin)</p>

<p>The Ebola Virus antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets the glycoprotein found on the surface of the Ebola virus. This antibody has been extensively studied and proven to be effective in neutralizing the virus by inhibiting its entry into host cells.</p>

<p>TSH beta antibody was raised in mouse using human TSH beta as the immunogen.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>HIV1 p24 antibody was raised in sheep using purified full length recombinant p24 as the immunogen.</p>

<p>Testosterone-19 antibody was raised in rabbit using Testosterone-19-HSA as the immunogen.</p>

<p>Luteinizing hormone beta antibody was raised in goat using human LH beta as the immunogen.</p>

<p>THC antibody was raised in sheep using tetrahydrocannabinol-KLH as the immunogen.</p>

<p>HIV1-RT antibody was raised in rabbit using full length recombinant RT (HIV-1) as the immunogen.</p>

<p>H-CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>HIV1 p24 antibody is a monoclonal antibody that specifically targets the p24 protein of the human immunodeficiency virus (HIV-1). This antibody has been widely used in research and diagnostic applications in the field of life sciences. It can be used for various purposes, such as detecting the presence of HIV-1 infection, studying viral replication and pathogenesis, and developing new therapeutic approaches. The HIV1 p24 antibody exhibits high specificity and sensitivity, making it a valuable tool for researchers and healthcare professionals working in the field of HIV/AIDS. Additionally, this antibody has cytotoxic properties that can be utilized for targeted therapy against HIV-infected cells. Its unique ability to bind to the p24 protein with high affinity makes it an essential component in the development of diagnostic tests and potential treatments for HIV/AIDS.</p>

<p>ApoA-I antibody was raised in mouse using human high density lipoprotein as the immunogen.</p>

<p>FITC antibody was raised in rabbit using fluorescein isothiocyanate-KLH as the immunogen.</p>

<p>Bradykinin antibody was raised in rabbit using bradykinin-BSA as the immunogen.</p>

<p>Peptide H-SHGQDYLVGNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Goat polyclonal Human Gc Globulin antibody</p>

<p>Rabbit Polyclonal HIV1 protease antibody</p>

<p>Goat anti Human kappa + lambda light chain secondary antibody</p>

<p>Rabbit anti Chicken IgY antibody</p>

<p>Plasminogen antibody was raised in goat using plasminogen isolated from normal human Plasma as the immunogen.</p>

<p>Trypsin antibody was raised in rabbit using human pancreatic trypsin as the immunogen.</p>

<p>Purified recombinant HIV1 protease IIIB (HRP)</p>

<p>Mouse monoclonal HIV1 gp41 antibody (FITC)</p>

<p>Goat anti Human Kappa light chain antibody</p>

<p>Goat polyclonal Human Properdin antibody</p>

<p>Goat polyclonal Human Complement C3 antibody</p>

<p>Phosphothreonine antibody was raised in rabbit using phosphothreoning as the immunogen.</p>

<p>Rabbit anti Human IgE is a highly effective neutralizing antibody that targets human serum. It has been specifically developed to combat the presence of autoantibodies and chemokines in the body. This antibody is widely used in the field of Life Sciences and has shown remarkable results in neutralizing agonist proteins. Additionally, Rabbit anti Human IgE has been proven to react with various proteins such as serum albumin protein and epidermal growth factor. With its high reactivity, this monoclonal antibody is an excellent tool for researchers studying cell antigens and seeking to develop targeted therapies. Trust Rabbit anti Human IgE to provide accurate and reliable results in your scientific endeavors.</p>

<p>Leishmania Infantum K39-LinJ Chimeric Antigen, Recombinant is a protein for use in pharmaceutical and diagnostic applications. Please enquire for more information about Leishmania Infantum K39-LinJ Chimeric Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Goat polyclonal FABP antibody</p>

<p>HIV2 gp105 antibody was raised in rabbit using purified, full length recombinant gp105 (HIV-2 ROD) as the immunogen.</p>

<p>Purified recombinant HIV1 tat HxB2 (FITC)</p>

<p>ELISA kit for the detection of Cardiolipin IgG/IgM1 in the research laboratory</p>

<p>Purified recombinant HIV1 p24 protein (HRP)</p>

<p>Guinea pig polyclonal Goat Serum antibody</p>

<p>Rabbit polyclonal CD4 (T-cell) antibody (FITC)</p>

<p>Goat anti Human IgM antibody</p>

<p>Goat polyclonal Human AFP antibody</p>

<p>Polyclonal SIV mac251 gp28 antibody (biotin)</p>

<p>Myoglobin antibody was raised in goat using human heart myoglobin as the immunogen.</p>

<p>Calcitonin antibody is a monoclonal antibody that specifically targets calcitonin, a hormone involved in regulating calcium levels in the body. This antibody has been extensively studied and shown to have high affinity for calcitonin, making it an effective tool for research and diagnostic purposes.<br><br>One of the key characteristics of this antibody is its ability to detect autoantibodies against calcitonin in human serum. These autoantibodies are associated with certain autoimmune disorders and can provide valuable insights into disease progression and treatment options.<br><br>Additionally, this antibody has been used in studies involving basic protein research. It can effectively bind to calcitonin and other related proteins, enabling researchers to study their functions and interactions.<br><br>Moreover, the calcitonin antibody has been utilized as a tool in various immunoassays. It can be conjugated with different labels such as biotin or fluorescent dyes, allowing for easy detection and quantification of calcitonin levels in biological samples.<br><br>Furthermore, this antibody has neutral</p>

<p>Purified recombinant HTLV1 gp21 (HRP)</p>

<p>Goat anti-guinea pig IgG was raised in goat using highly pure normal guinea pig serum as the immunogen.</p>

<p>M13K07 (delta) helper phage for use in phage display technology</p>

<p>Purified CD4 (T-cell receptor) protein (FITC)</p>

<p>Goat anti Human IgA antibody</p>

<p>Goat anti Human IgG Fc + IgD antibody</p>

<p>Goat polyclonal anti Human Lambda light chain antibody</p>

<p>Goat polyclonal Human CRP antibody</p>

<p>Goat polyclonal Plasminogen antibody</p>

<p>NT-proBNP Positive Human Li Heparin Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about NT-proBNP Positive Human Li Heparin Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Goat anti Human IgG Fc antibody</p>

<p>Rabbit polyclonal Cystatin C antibody</p>

<p>Goat polyclonal Human Complement factor 5 antibody</p>

<p>Goat anti Human IgM antibody</p>

<p>Goat polyclonal anti Human Lambda light chain antibody</p>

<p>Goat polyclonal Human BNP antibody</p>

<p>Goat polyclonal FABP antibody</p>

<p>Please enquire for more information about Anti-Rubella IgM Positive Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about LKM-1 Antibody Positive Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Luteinizing hormone antibody was raised in goat using human LH as the immunogen.</p>

<p>Insulin antibody was raised in mouse using human insulin as the immunogen.</p>

<p>Thyroxine antibody was raised in sheep using T4-BSA as the immunogen.</p>

<p>Goat polyclonal CRP antibody</p>

<p>Goat polyclonal Cystatin C antibody</p>

<p>Mouse monoclonal HIV1 Nef C-terminal antibody (biotin)</p>

<p>COX2 antibody was raised in mouse using recombinant human COX 2 protein as the immunogen.</p>

<p>Goat polyclonal Human Transferrin antibody</p>

<p>Elastase antibody was raised in rabbit using elastase as the immunogen.</p>

<p>Goat polyclonal Human Plasminogen antibody</p>

<p>Goat anti Human Kappa light chain antibody</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Goat polyclonal Whole Human Serum antibody</p>

<p>Brain natriuretic peptide (BNP) circulates in blood as a peptide hormone with natriuretic, vasodilatory and renin inhibitory properties. BNP is secreted predominantly by the left ventricular myocytes in response to volume expansion and pressure overload. BNP belongs to a family of structurally similar peptide hormones, which includes atrial natriuretic peptide (ANP), BNP, C type natriuretic peptide (CNP) and urodilatin.</p>

<p>HIV1 gp120 antibody was raised in rabbit using full length recombinant gp120 (HIV-1) as the immunogen.</p>

<p>PTH antibody was raised in goat using human PTH human as the immunogen.</p>

<p>Troponin I antibody (cardiac) was raised in goat using human cardiac troponin I as the immunogen.</p>

<p>Purified recombinant HTLV1 gp46 protein</p>

<p>ApoA-II antibody was raised in goat using highly purified human APO A-II as the immunogen.</p>

<p>Goat polyclonal Human alpha 2 Macroglobulin antibody</p>

<p>Goat anti rabbit IgG was raised in goat using highly purified rabbit IgG as the immunogen.</p>

<p>HIV1 p24 antibody (FITC) was raised in mouse using purified, full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.</p>

<p>Peptide H-SAYVSYDVQK^R^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>ELISA kit for the detection of beta 2 Glycoprotein I IgG/IgM in the research laboratory</p>

<p>Borrelia burgdorferi antibody was raised in sheep using lyme disease (Borrelia Burdorferi) as the immunogen.</p>

<p>Progesterone antibody was raised in rabbit using 17a-OH progesterone -3-CMO-BSA as the immunogen.</p>

<p>HIV1 p24 antibody (biotin) was raised in goat using purified, full length recombinant p24 (HIV-1 IIIB) produced in baculovirus expression system as the immunogen.</p>

<p>SLE IgG Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about SLE IgG Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Goat polyclonal Human Haptoglobin antibody</p>

<p>The ST2 antibody is a powerful tool in the field of Life Sciences. It specifically targets the IL-1 receptor and its binding proteins, making it an essential component in various experiments and research studies. The ST2 antibody is produced by a hybridoma cell line and has been extensively characterized for its specificity and potency.<br><br>One of the key applications of the ST2 antibody is its use as a neutralizing agent for interleukin (IL) signaling pathways. By blocking the interaction between IL-1 receptor and its ligands, the ST2 antibody effectively inhibits downstream signaling events, providing valuable insights into cellular responses mediated by IL-1.<br><br>Moreover, the ST2 antibody has been shown to have a high affinity for histone H1, a protein involved in chromatin structure and gene regulation. This interaction suggests that the ST2 antibody may play a role in modulating chromatin dynamics and epigenetic processes.<br><br>In addition to its research applications, the ST2 antibody can also be used as a</p>

<p>Goat polyclonal Human ApoB antibody</p>

<p>Purified recombinant TPO protein (His tag)</p>

<p>CD4 antibody was raised in rabbit using human T-Cell CD4 serum as the immunogen.</p>

<p>HIV1 p24 antibody (FITC) was raised in rabbit using full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.</p>

<p>Ketoconazole is a versatile powder that has neutralizing properties and can be used in various applications in the Life Sciences field. It is commonly used as a growth factor in Biological Reagents, where it promotes the growth and development of cells. Additionally, ketoconazole is known for its ability to interact with antibodies, including monoclonal antibodies and trifunctional antibodies, enhancing their effectiveness.</p>

<p>SK channel blocker</p>

<p>Purified recombinant HIV-1 p17 IIIB (FITC)</p>

<p>Mouse monoclonal CD4 antibody (biotin); IgG1; 50 ug/vial; clone 45</p>

<p>HIV1 p17 antibody (HRP) was raised in goat using recombinant p17 (HIV-1) produced in E. coli as the immunogen.</p>

<p>Please enquire for more information about Anti-Rubella IgM Positive Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>FSH antibody was raised in mouse using highly purified FSH as the immunogen.</p>

<p>Goat anti Human Kappa light chain antibody</p>

<p>cGMP antibody was raised in rabbit using cGMP-BSA as the immunogen.</p>

<p>Goat polyclonal Human Complement C3 antibody</p>

<p>Purified native Human PSA/ACT Complex protein</p>

<p>TSH antibody was raised in goat using human TSH whole molecule as the immunogen.</p>

<p>Streptococcus group A antibody was raised in goat using group A Streptococci as the immunogen.</p>

<p>Orientia Tsutsugamushi p56 Antigen, Recombinant is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Orientia Tsutsugamushi p56 Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Goat anti Human IgE antibody</p>

<p>Mouse monoclonal Legionella pneumophila LPS antibody</p>

<p>Mouse monoclonal HIV1 tat antibody (biotin)</p>

<p>Treponema pallidum antibody was raised in goat using Treponema pallidum as the immunogen.</p>

<p>Human IgE antibody was raised in goat using human IgE as the immunogen.</p>

<p>Orosomucoid antibody was raised in rabbit using rat alpha-1 acid glycoprotein as the immunogen.</p>

<p>Mouse monoclonal HSV2 gD antibody</p>

<p>Estradiol antibody was raised in rabbit using estradiol-6-protein preparation as the immunogen.</p>

<p>Folic acid antibody was raised in rabbit using folic acid-BSA as the immunogen.</p>

<p>CD4 antibody was raised in mouse using full length recombinant CD4 (T cell) produced in baculovirus expression system as the immunogen.</p>

<p>CD4 antibody was raised in mouse using full length CD4 (T cell receptor) produced in baculovirus expression system as the immunogen.</p>

<p>Purified recombinant HIV1 rev HxB2/HxB3 (FITC)</p>

<p>CMV antibody was raised in mouse using CMV as the immunogen.</p>

<p>Please enquire for more information about H-DASSGVEAAAGLGESVAITH-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Goat polyclonal Human Transferrin antibody</p>

<p>Peptide H-LVYHLGLPFSFLTFPYVEEAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Digoxin antibody was raised in rabbit using digoxin-BSA as the immunogen.</p>

<p>PTH antibody was raised in goat using human PTH as the immunogen.</p>

<p>HSV1 gE antibody was raised in mouse using herpes simplex virus I glycoprotein E (gE) as the immunogen.</p>

<p>PTH antibody was raised in goat using human PTH as the immunogen.</p>

<p>Peptide TAPI-2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>

<p>HIV1 p24 antibody (IgG purified) was raised in sheep using purified full length recombinant p24 as the immunogen.</p>

<p>HIV1 Nef antibody was raised in mouse using full length recombinant nef (HIV-1) as the immunogen.</p>

<p>Mouse monoclonal HIV2 gp36 antibody</p>

<p>The HIV1 Nef protein is a crucial component in the study of Life Sciences and has various applications in research and diagnostics. It is an antigen binding molecule that can be used in immunoassays and as a tool for studying receptor binding. The HIV1 Nef protein can be detected using colloidal or monoclonal antibodies, which specifically bind to this protein. These binding proteins are highly specific and can be used to detect the presence of the HIV1 Nef protein in samples.</p>

<p>Peptide TAPI-1 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Amphetamine antibody was raised in goat using amphetamine-ovalbumin as the immunogen.</p>

<p>SOD antibody was raised in sheep using human SOD purified from the liver liver as the immunogen.</p>

<p>Rabbit polyclonal HIV2 gp105 antibody</p>

<p>FBP antibody was raised in rabbit using bovine milk as the immunogen.</p>

<p>Morphine 6 antibody was raised in goat using 6-carboxymethyl-morphine-BSA as the immunogen.</p>

<p>CA 125 ELISA kit for detection of CA125 in the research laboratory</p>

<p>AFP antibody was raised in goat using human AFP from cord serum as the immunogen.</p>

<p>Ferritin antibody was raised in rabbit using human liver ferritin as the immunogen.</p>

<p>Serotonin ELISA Kit for the rapid quantitative determination of Serotonin in serum, urine and platelets</p>

<p>Mouse monoclonal CD4 (T-cell) antibody (FITC); IgG1; 50 ug/vial; clone 4</p>

<p>ApoB antibody was raised in mouse using human low density lipoprotein as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, thereby inhibiting bacterial growth and preventing transcription and replication. Extensive research has shown its high efficacy on human erythrocytes using a patch-clamp technique.</p>

<p>Phenobarbital antibody was raised in goat using phenobarbitol-KLH as the immunogen.</p>

<p>HIV1 integrase antibody was raised in mouse using full length recombinant Integrase (HIV-1, IIIB) as the immunogen.</p>

<p>TSH antibody was raised in mouse using TSH from the human pituitary as the immunogen.</p>

<p>The hCG beta antibody is a monoclonal antibody that specifically targets and neutralizes the human chorionic gonadotropin (hCG) beta subunit. This antibody is known to form dimers, which enhance its binding affinity and neutralizing activity against hCG. It has been widely used in life sciences research to study the role of hCG in various biological processes.</p>

<p>HTLV-1 antibody (FITC) was raised in mouse using HTLV-1 (DIVmac251) as the immunogen.</p>

<p>Goat anti Human IgG Fc antibody</p>

<p>Mouse monoclonal HIV1 Nef antibody (FITC)</p>

<p>CD4 antibody was raised in rabbit using human T-Cell CD4 serum as the immunogen.</p>

<p>Mouse monoclonal HIV2 gp105 antibody</p>

<p>ELISA kit for the detection of dsDNA IgG in the research laboratory</p>

<p>cAMP antibody was raised in rabbit using succinyl-cAMP-BSA as the immunogen.</p>

<p>Goat polyclonal Troponin I antibody</p>

<p>C Peptide antibody was raised in guinea pig using synthetic human C-Peptide as the immunogen.</p>

<p>Rabbit polyclonal HIV-1 gp160 antibody</p>

<p>LDH antibody was raised in rabbit using porcine lactate dehydrogenase-H4 as the immunogen.</p>

<p>Triiodothyronine antibody was raised in rabbit using T3-BSA as the immunogen.</p>

<p>Sirt7 inhibitor 97491 is an anticancer drug that works by inhibiting the activity of Sirt7, a protein that promotes tumor growth. This inhibitor has been shown to be effective in human cancer cell lines and may have potential for use in cancer therapy. The drug has been tested in Chinese hamster ovary cells and was found to induce apoptosis, or programmed cell death, in these cells. Sirt7 inhibitor 97491 is an analog of chloroquine and can also inhibit kinases, which are enzymes involved in signaling pathways that regulate cell growth and division. In addition, this inhibitor has been found to increase the effectiveness of other anticancer drugs such as artesunate. Overall, Sirt7 inhibitor 97491 is a promising new drug candidate for the treatment of cancer.</p>

<p>Goat anti Human IgG Fc antibody</p>

<p>Rabbit polyclonal Phosphatidylserine antibody</p>

<p>AFP antibody was raised in rabbit using human AFP as the immunogen.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Glucagon antibody was raised in rabbit using porcine glucagon-BSA as the immunogen.</p>

<p>Cortisol Saliva ELISA Kit</p>

<p>The HIV1 tat antibody is a highly specialized monoclonal antibody that targets the HIV-1 Tat protein. This protein plays a crucial role in the replication and transmission of the virus. The HIV1 tat antibody has been extensively studied and has shown potent neutralizing activity against the Tat protein, inhibiting its function and preventing viral replication.</p>

<p>Oxyphenbutazone antibody was raised in rabbit using oxyphenbutazone-KLH as the immunogen.</p>

<p>Rabbit polyclonal HIV1 Rev antibody (biotin)</p>

<p>FSH Beta antibody was raised in rabbit using FSH beta-KLH as the immunogen.</p>

<p>Goat polyclonal Human Cystatin C antibody</p>

<p>Peptide H-NLDTASTTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VYIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Key subunit of extracellular plaques found in the brains of patients with Alzheimer's disease. TFA salt; 95%.</p>

<p>Peptide H-WRQAAFVDSY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VAANIVLTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-KLQVFLIVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Prostaglandin A1 is a bioactive lipid, which is derived from arachidonic acid through enzymatic pathways. It functions as a signaling molecule with various biological activities, influencing vascular tone, inflammation, and smooth muscle activity. Prostaglandins are a subset of eicosanoids, which are synthesized from essential fatty acids found within phospholipid membranes of cells.</p>

<p>UM171 is a small-molecule compound, which is derived from synthetic chemical processes with properties that enable the expansion of human hematopoietic stem cells (HSCs) in vitro. It acts by targeting and modulating specific cellular pathways to enhance the self-renewal and proliferation of HSCs without inducing differentiation.<br><br>The primary application of UM171 lies in the field of regenerative medicine and transplantation. By facilitating the expansion of HSCs, UM171 holds significant potential in improving the outcomes of bone marrow and cord blood transplants. This is particularly relevant in contexts where donor cell availability is limited or where augmenting the engraftment potential of HSCs is critical. The ability to expand HSCs ex vivo opens avenues for improved treatment of hematological disorders, potentially allowing for more effective and accessible transplant therapies. Researchers are exploring its utility in diverse experimental setups, aiming to translate this compound's capabilities into clinical settings to enhance patient outcomes in hematopoietic recovery and therapy.</p>

<p>Peptide H-GYGFGLIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>TAPI-1 is an inhibitor of TACE (TNF-α converting enzyme, also known as ADAM17) and matrix metalloproteinases (MMPs). It blocks the shedding of several cell surface proteins, including tumor necrosis factor-alpha (TNF-α), IL-6 receptor, and TNF receptors p60 (TNFRI) and p80 (TNFRII).</p>

<p>A hydroxamate-based inhibitor of collagenase, gelatinase, and TACE. TACE stands for Tumor Necrosis Factor-α Converting Enzyme. It is also known as ADAM17 (A Disintegrin and Metalloproteinase 17)</p>

<p>Peptide H-WHWLQLKPGQPMY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-WHWLQLKPGQPMY-OH include the following: Position one analogs of the Saccharomyces cerevisiae tridecapeptide pheromone YL Zhang, HUIFEN LU, JM Becker - The Journal of peptide , 1997 - Wiley Online Library<a href="https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1997.tb01190.x" target="_blank" rel="noreferrer noopener">https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1997.tb01190.x</a> Synthesis, Biological Activity, and Conformational Analysis of Peptidomimetic Analogues of the Saccharomyces cerevisiae alpha-Factor Tridecapeptide YL Zhang, HR Marepalli, H Lu, JM Becker - Biochemistry, 1998 - ACS Publications<a href="https://pubs.acs.org/doi/abs/10.1021/bi980787u" target="_blank" rel="noreferrer noopener">https://pubs.acs.org/doi/abs/10.1021/bi980787u</a> Receptor in Saccharomyces cereuisiae SK RathsSQ, M BeckerSII - researchgate.net<a href="https://www.researchgate.net/profile/Jeffrey-Becker-2/publication/20308809_Peptide_analogs_compete_with_binding_of_-factor_to_its_receptor_in_Saccharomyces_cerevisiae/links/09e415111549c85414000000/Peptide-analogs-compete-with-binding-of-factor-to-its-receptor-in-Saccharomyces-cerevisiae.pdf" target="_blank" rel="noreferrer noopener">https://www.researchgate.net/profile/Jeffrey-Becker-2/publication/20308809_Peptide_analogs_compete_with_binding_of_-factor_to_its_receptor_in_Saccharomyces_cerevisiae/links/09e415111549c85414000000/Peptide-analogs-compete-with-binding-of-factor-to-its-receptor-in-Saccharomyces-cerevisiae.pdf</a> Peptide analogues compete with the binding of alpha-factor to its receptor in Saccharomyces cerevisiae. SK Raths, F Naider, JM Becker - Journal of Biological Chemistry, 1988 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0021925819778405" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0021925819778405</a> Binding of fluorinated phenylalanine alpha-factor analogues to ste2p: Evidence for a cation-Ï€ binding interaction between a peptide ligand and its cognate G protein S Tantry, FX Ding, M Dumont , JM Becker, F Naider - Biochemistry, 2010 - ACS Publications<a href="https://pubs.acs.org/doi/abs/10.1021/bi100280f" target="_blank" rel="noreferrer noopener">https://pubs.acs.org/doi/abs/10.1021/bi100280f</a> Position 13 analogs of the tridecapeptide mating pheromone from Saccharomyces cerevisiae: design of an iodinatable ligand for receptor binding S Liu, B Arshava, F Naider, LK Henry - Journal of Peptide , 2000 - Wiley Online Library<a href="https://onlinelibrary.wiley.com/doi/abs/10.1034/j.1399-3011.2000.00730.x" target="_blank" rel="noreferrer noopener">https://onlinelibrary.wiley.com/doi/abs/10.1034/j.1399-3011.2000.00730.x</a> Ab initio calculations on Pro-Ala and Pro-Gly dipeptides O Antohi, F Naider, AM Sapse - Journal of Molecular Structure , 1996 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/0166128095043608" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/0166128095043608</a> Structural requirement tryptophan1,3 of tridecapeptide mating pheromone of Saccharomyces cerevisiae NJ Hong, YA Park, JW Lee - : Proceedings of the 1st International Peptide , 2002 - Springer<a href="https://link.springer.com/content/pdf/10.1007/0-306-46864-6_157.pdf" target="_blank" rel="noreferrer noopener">https://link.springer.com/content/pdf/10.1007/0-306-46864-6_157.pdf</a> Studies on conformational consequences of i to i+ 3 side-chain cyclization in model cyclic tetrapeptides MH RAO, WEI YANG, H JOSHUA - Journal of Peptide , 1995 - Wiley Online Library<a href="https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1995.tb01057.x" target="_blank" rel="noreferrer noopener">https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1995.tb01057.x</a> Specificity characterization of the alpha-mating factor hormone by Kex2 protease MA Manfredi, AA Antunes, LOP Jesus, MA Juliano - Biochimie, 2016 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0300908416302358" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0300908416302358</a> Control of the yeast cell cycle with a photocleavable alpha-factor analogue LL Parker , JW Kurutz, SBH Kent - Chemie (International ed , 2006 - ncbi.nlm.nih.gov<a href="https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2788609/" target="_blank" rel="noreferrer noopener">https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2788609/</a> Matrix-assisted laser desorption/ionization mass spectrometry peptide sequencing utilizing selective N-terminal bromoacetylation J Song, HJ Kim - Analytical biochemistry, 2012 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0003269711007548" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0003269711007548</a> Solution Structures of i to i + 3 Cyclized Model Peptides: Building Blocks Mimicking Specific Conformations HR Marepalli, O Antohi, JM Becker - Journal of the American , 1996 - ACS Publications<a href="https://pubs.acs.org/doi/abs/10.1021/ja954217i" target="_blank" rel="noreferrer noopener">https://pubs.acs.org/doi/abs/10.1021/ja954217i</a> Highly active analogs of alpha-factor and their activities against Saccharomyces cerevisiae HJ Ahn, EY Hong, DH Jin, NJ Hong - Bulletin of the Korean Chemical , 2014 - Citeseer<a href="https://citeseerx.ist.psu.edu/document?repid=rep1&amp;type=pdf&amp;doi=509ee315e2cbcb9fac108f48dfb1fa89d076f1b2" target="_blank" rel="noreferrer noopener">https://citeseerx.ist.psu.edu/document?repid=rep1&amp;type=pdf&amp;doi=509ee315e2cbcb9fac108f48dfb1fa89d076f1b2</a> Identification of residue-to-residue contact between a peptide ligand and its G protein-coupled receptor using periodate-mediated dihydroxyphenylalanine cross GKE Umanah, L Huang , F Ding, B Arshava - Journal of biological , 2010 - ASBMB<a href="https://www.jbc.org/article/S0021-9258(20)60639-1/abstract" target="_blank" rel="noreferrer noopener">https://www.jbc.org/article/S0021-9258(20)60639-1/abstract</a> Cross-linking of a DOPA-containing peptide ligand into its G protein-coupled receptor GKE Umanah, C Son , FX Ding, F Naider - Biochemistry, 2009 - ACS Publications<a href="https://pubs.acs.org/doi/abs/10.1021/bi802061z" target="_blank" rel="noreferrer noopener">https://pubs.acs.org/doi/abs/10.1021/bi802061z</a> Structural requirements for alpha-mating factor activity G Houen, O Nielsen, C Flanagan - FEBS letters, 1996 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/0014579396007260" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/0014579396007260</a> The alpha-factor mating pheromone of Saccharomyces cerevisiae: a model for studying the interaction of peptide hormones and G protein-coupled receptors F Naider, JM Becker - Peptides, 2004 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0196978104002943" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0196978104002943</a> Studies on the yeast alpha-mating factor: A model for mammalian peptide hormones F Naider, J Gounarides, CB Xue - Biopolymers , 1992 - Wiley Online Library<a href="https://onlinelibrary.wiley.com/doi/abs/10.1002/bip.360320407" target="_blank" rel="noreferrer noopener">https://onlinelibrary.wiley.com/doi/abs/10.1002/bip.360320407</a> Probing the Binding Site of a Heptahelical Peptide Pheromone Receptor Using Photoaffinity Labelling, Site-Directed Mutagenesis and Spectroscopic Approaches F Naider, BK Lee, LK Henry, F Ding, SK Khare - Peptides: The Wave of , 2001 - Springer<a href="https://link.springer.com/chapter/10.1007/978-94-010-0464-0_409" target="_blank" rel="noreferrer noopener">https://link.springer.com/chapter/10.1007/978-94-010-0464-0_409</a> Biophysical studies on a transmembrane peptide of the Saccharomyces cerevisiae alpha-factor receptor F Naider, B Arshava, H Xie, S Liu, WY Eng - Peptides for the New , 2002 - Springer<a href="https://link.springer.com/content/pdf/10.1007/0-306-46881-6_151.pdf" target="_blank" rel="noreferrer noopener">https://link.springer.com/content/pdf/10.1007/0-306-46881-6_151.pdf</a> Characterization of novel peptide agonists of the alpha mating factor of Saccharomyces cerevisiae EG Siegel, R Gunther, H Schafer, UR Fölsch - Analytical , 1999 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0003269799942896" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0003269799942896</a> Antagonistic and synergistic peptide analogs of the tridecapeptide mating pheromone of Saccharomyces cerevisiae E Eriotou-Bargiota , CB Xue, F Naider, JM Becker - Biochemistry, 1992 - ACS Publications<a href="https://pubs.acs.org/doi/pdf/10.1021/bi00117a036" target="_blank" rel="noreferrer noopener">https://pubs.acs.org/doi/pdf/10.1021/bi00117a036</a> Probing the functional conformation of the tridecapeptide mating pheromone of Saccharomyces cerevisiae through study of disulfide-constrained analogs CHUB XUE, A MCKINNEY, HUIFEN LU - journal of peptide , 1996 - Wiley Online Library<a href="https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1996.tb01336.x" target="_blank" rel="noreferrer noopener">https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1996.tb01336.x</a> Spiegel, zyxwvutsrqponm B Molitoris, AC Alfrey, RA Harris, FR Simon - Am. J. Physiol, 1985 - academia.edu<a href="https://www.academia.edu/download/41221846/Antagonistic_and_synergistic_peptide_ana20160115-15517-198v4vt.pdf" target="_blank" rel="noreferrer noopener">https://www.academia.edu/download/41221846/Antagonistic_and_synergistic_peptide_ana20160115-15517-198v4vt.pdf</a> Long-distance rotational echo double resonance measurements for the determination of secondary structure and conformational heterogeneity in peptides B Arshava, M Breslav, O Antohi, RE Stark - Solid State Nuclear , 1999 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0926204099000181" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0926204099000181</a> Synthesis of biologically active analogs of the dodecapeptide alpha-factor mating pheromone of Saccharomyces cerevisiae A EWENSON, S MARCUS - Journal of Peptide , 1990 - Wiley Online Library<a href="https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1990.tb00944.x" target="_blank" rel="noreferrer noopener">https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1990.tb00944.x</a></p>

<p>Peptide H-ALNRTSSDSALHRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ALNRTSSDSALHRRR-OH include the following: Enhanced activation of cellular AMPK by dual-small molecule treatment: AICAR and A769662 S Ducommun , RJ Ford, L Bultot - American Journal , 2014 - journals.physiology.org<a href="https://journals.physiology.org/doi/abs/10.1152/ajpendo.00672.2013" target="_blank" rel="noreferrer noopener">https://journals.physiology.org/doi/abs/10.1152/ajpendo.00672.2013</a> Characterization of WZ4003 and HTH-01-015 as selective inhibitors of the LKB1-tumour-suppressor-activated NUAK kinases S Banerjee , SJ Buhrlage, HT Huang , X Deng - Biochemical , 2014 - portlandpress.com<a href="https://portlandpress.com/biochemj/article-abstract/457/1/215/46906" target="_blank" rel="noreferrer noopener">https://portlandpress.com/biochemj/article-abstract/457/1/215/46906</a> Interplay between Polo kinase, LKB1-activated NUAK1 kinase, PP1betaMYPT1 phosphatase complex and the SCFbetaTrCP E3 ubiquitin ligase S Banerjee , A Zagorska, M Deak - Biochemical , 2014 - portlandpress.com<a href="https://portlandpress.com/biochemj/article-abstract/461/2/233/46874" target="_blank" rel="noreferrer noopener">https://portlandpress.com/biochemj/article-abstract/461/2/233/46874</a> Inhibition of SIK2 and SIK3 during differentiation enhances the anti-inflammatory phenotype of macrophages NJ Darling , R Toth, JSC Arthur , K Clark - Biochemical Journal, 2017 - portlandpress.com<a href="https://portlandpress.com/biochemj/article-abstract/474/4/521/49590" target="_blank" rel="noreferrer noopener">https://portlandpress.com/biochemj/article-abstract/474/4/521/49590</a> Comparison of the specificity of Trk inhibitors in recombinant and neuronal assays KJ Martin, N Shpiro, R Traynor, M Elliott , JSC Arthur - Neuropharmacology, 2011 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0028390811001389" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0028390811001389</a> Enhanced activation of cellular AMPK by dual small GR Kemp, K Sakamoto - 2014 - journals.physiology.org<a href="https://journals.physiology.org/doi/prev/20140114-aop/epdf/10.1152/ajpendo.00672.2013" target="_blank" rel="noreferrer noopener">https://journals.physiology.org/doi/prev/20140114-aop/epdf/10.1152/ajpendo.00672.2013</a> The AMPK-related kinase SIK2 is regulated by cAMP via phosphorylation at Ser358 in adipocytes E Henriksson, HA Jones, K Patel , M Peggie - Biochemical , 2012 - portlandpress.com<a href="https://portlandpress.com/biochemj/article-abstract/444/3/503/46279" target="_blank" rel="noreferrer noopener">https://portlandpress.com/biochemj/article-abstract/444/3/503/46279</a></p>