Compuestos y reactivos bioquímicos

<p>MUC3B antibody was raised using the middle region of MUC3B corresponding to a region with amino acids KTTLKEGLQNASQDANSCQDSQTLCFKPDSIKVNNNSKTELTPEAICRRA</p>

<p>Rabbit polyclonal RNASEH1 antibody</p>

<p>Rabbit polyclonal Transaldolase antibody (HRP)</p>

<p>Rabbit polyclonal ZNF750 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication, ultimately inhibiting bacterial growth. Extensive research has shown its high efficacy in human erythrocytes using a patch-clamp technique.</p>

<p>LETMD1 antibody was raised using the middle region of LETMD1 corresponding to a region with amino acids LLRHRLKTHTTVIHQLDKALAKLGIGQLTAQEVKSACYLRGLNSTHIGED</p>

<p>Rabbit polyclonal STXBP3 antibody</p>

<p>TAPBP antibody was raised using a synthetic peptide corresponding to a region with amino acids GEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHS</p>

<p>PRKCG antibody was raised using the middle region of PRKCG corresponding to a region with amino acids WSFGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKG</p>

<p>DPPA2 antibody was raised using the N terminal of DPPA2 corresponding to a region with amino acids NMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQFTAPQKARCKIPALPL</p>

<p>OXSM antibody was raised using the middle region of OXSM corresponding to a region with amino acids HAVQRRARIYAEVLGYGLSGDAGHITAPDPEGEGALRCMAAALKDAGVQP</p>

<p>Gm13178 antibody was raised in rabbit using the C terminal of Gm13178 as the immunogen</p>

<p>CD45 antibody was raised in mouse using recombinant human CD45 (1029-1249aa) purified from E. coli as the immunogen.</p>

<p>Lidocaine antibody was raised in mouse using lidocaine conjugated to KLH as the immunogen.</p>

<p>17b-Trenbolone 17 Conjugate for use in immunoassays</p>

<p>PHF10 antibody was raised using the middle region of PHF10 corresponding to a region with amino acids PELPALDSDGDSDDGEDGRGDEKRKNKGTSDSSSGNVSEGESPPDSQEDS</p>

<p>The Il33 protein is a versatile and essential component in the field of Life Sciences. It plays a crucial role in various biological processes, including cell growth, differentiation, and immune response regulation. This protein has garnered significant attention due to its potential therapeutic applications.</p>

<p>Rat thymocyte antibody was raised in rabbit using RBC-free rat thymocytes as the immunogen.</p>

<p>Mouse monoclonal MHC Class I antibody (PE)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SP1 antibody, catalog no. 70R-4097</p>

<p>ADH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLTNLCGKISNLKSPASDQQLMEDKTSRFTCKGKPVYHFFGTSTFSQYTV</p>

<p>The CD45RA antibody is a monoclonal antibody that targets the CD45RA protein, which is expressed on certain immune cells. It has been shown to be effective in inhibiting the growth of Corynebacterium glutamicum, a bacterium commonly used in the production of amino acids. The CD45RA antibody can also block the activity of enzymes involved in collagen degradation, leading to potential applications in the field of regenerative medicine and tissue engineering. Additionally, this antibody has been used in Life Sciences research to study various cellular processes, including substrate sirna delivery, modulation of β-catenin signaling, and phosphorylcholine metabolism. Its versatility makes it a valuable tool for scientists studying immune responses, growth factors, sugar phosphotransferase activity, and even certain pathogens like Helicobacter pylori.</p>

<p>Insulin antibody is a highly specialized antibody that plays a crucial role in regulating glucose metabolism. It is cytotoxic and can neutralize the effects of insulin by binding to it. This antibody has been widely used in research and clinical settings to study various aspects of insulin function.</p>

<p>Purified recombinant MMP8 protein (His tag)</p>

<p>Purified Rabbit polyclonal VAV2 antibody (Tyr142)</p>

<p>AKTIP antibody was raised using the middle region of AKTIP corresponding to a region with amino acids NPSVHDEAREKMLTQKKPEEQHNKSVHVAGLSWVKPGSVQPFSKEEKTVA</p>

<p>Human IgM antibody was raised in mouse using human IgM as the immunogen.</p>

FTCD antibody was raised using the middle region of FTCD corresponding to a region with amino acids KFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEK

<p>Rabbit polyclonal FTH1 antibody (FITC)</p>

<p>Rabbit polyclonal SUCLA2 antibody</p>

<p>CD3 antibody (Spectral Red) was raised in mouse using the epsilon chain of CD3/T-cell antigen receptor complex as the immunogen.</p>

<p>SULT2B1 antibody was raised using the middle region of SULT2B1 corresponding to a region with amino acids YSKIAGQLKDPGTPDQFLRDFLKGEVQFGSWFDHIKGWLRMKGKDNFLFI</p>

<p>Chymotrypsin antibody was raised in rabbit using human pancreatic chymotrypsin as the immunogen.</p>

<p>Purified recombinant NAP1L4 protein (His tag)</p>

<p>Rabbit polyclonal SNRPD2 antibody</p>

<p>Rat monoclonal CD45 antibody (FITC)</p>

<p>Septin 10 antibody was raised using the C terminal of 40431 corresponding to a region with amino acids ERMKLEEKRRLLEEEIIAFSKKKATSEIFHSQSFLATGSNLRKDKDRKNS</p>

<p>ETV3 antibody was raised in mouse using recombinant Ets Variant Gene 3</p>

<p>Nanog antibody was raised using the N terminal of NANOG corresponding to a region with amino acids ESSLTPVTCGPEENYPSLQMSSAEMPHAETVSPLPSSMDLLIQDSPDSST</p>

<p>ACD antibody was raised using a synthetic peptide corresponding to a region with amino acids KNRPPFPRTGATRGAQEPCSVWEPPKRHRDGSAFQYEYEPPCTSLCARVQ</p>

<p>TNFSF13B antibody was raised using a synthetic peptide corresponding to a region with amino acids ALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAP</p>

<p>Rabbit polyclonal SCML1 antibody</p>

<p>SOHLH2 antibody was raised in rabbit using the middle region of SOHLH2 as the immunogen</p>

<p>PEX5 antibody was raised using the middle region of PEX5 corresponding to a region with amino acids LNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLL</p>

<p>KLHL13 antibody was raised in rabbit using the N terminal of KLHL13 as the immunogen</p>

Desmoplakin 1+2 antibody was raised in mouse using synthetic peptide of human desmoplakin 2 as the immunogen.

<p>ZNF598 antibody was raised in rabbit using the middle region of ZNF598 as the immunogen</p>

<p>The PNMA5 antibody is an activated agent that targets autoantibodies against the PNMA5 protein. This protein is involved in various biological processes, including methylation and regulation of gene expression. The PNMA5 antibody can be used as a diagnostic tool to detect the presence of these autoantibodies in patient serum, making it a valuable serum marker for certain diseases. Additionally, this antibody can be used in research settings to study the function and role of PNMA5 in different cell types, including pluripotent stem cells. Its ability to bind specifically to the glycoprotein allows for accurate detection and analysis of PNMA5 levels. With its wide range of applications in Life Sciences, this antibody is a powerful tool for scientists studying interferon-stimulated genes, interleukins, dopamine receptors, acetylcholine receptors, and transmembrane conductance.</p>

<p>Purified recombinant BEST1 protein (His tag)</p>

<p>The MCM8 antibody is a highly specialized monoclonal antibody that targets the MCM8 protein, which plays a crucial role in DNA replication and cell cycle regulation. This antibody is derived from human serum and has been extensively tested for its efficacy and specificity.</p>