Compuestos y reactivos bioquímicos

<p>Mouse monoclonal Complement H antibody (Biotin)</p>

<p>Rabbit polyclonal Basigin antibody (FITC)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA0737 antibody, catalog no. 20R-1215</p>

<p>TTC9C antibody was raised using the N terminal of TTC9C corresponding to a region with amino acids MEKRLQEAQLYKEEGNQRYREGKYRDAVSRYHRALLQLRGLDPSLPSPLP</p>

<p>The SYN1 antibody is a highly specialized product used in the field of Life Sciences. It is a polyclonal antibody that specifically targets the SYN1 antigen. This antibody has been extensively tested and proven to be effective in various applications such as immunohistochemistry, western blotting, and enzyme-linked immunosorbent assay (ELISA).</p>

<p>MFRP antibody was raised using the middle region of MFRP corresponding to a region with amino acids HAIQLKIEALSIESVASCLFDRLELSPEPEGPLLRVCGRVPPPTLNTNAS</p>

<p>Rabbit polyclonal SMYD4 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C2orf55 antibody, catalog no. 70R-4287</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C2orf29 antibody, catalog no. 70R-4352</p>

<p>The Benzodiazepine antibody is a monoclonal antibody that has been developed for its neutralizing properties against hepatocyte growth factor (HGF). This antibody has been immobilized using chromatographic techniques, making it highly effective in targeting and neutralizing HGF. It binds to the protein collagen and angptl3, which are key binding proteins involved in the activation of HGF. The Benzodiazepine antibody has shown cytotoxic effects on cells that overexpress HGF receptors, making it a promising therapeutic option for conditions associated with abnormal HGF signaling. Additionally, this antibody has also demonstrated inhibitory effects on epidermal growth factor (EGF), further expanding its potential applications in various disease settings. With its targeted action and potent neutralizing capabilities, the Benzodiazepine antibody offers a promising avenue for therapeutic intervention in conditions characterized by dysregulated HGF signaling.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NUP43 antibody, catalog no. 70R-2178</p>

<p>The KLK5 antibody is a highly specialized monoclonal antibody that plays a crucial role in various biological processes. It acts as an inhibitor of endothelial growth factor, acidic neurotrophic factor, and colloidal antibodies. Additionally, it has neutralizing properties against glucagon and tyrosine growth factor.</p>

<p>The STAG2 antibody is a polypeptide used in Life Sciences research. It is a polyclonal antibody that specifically targets the STAG2 antigen. This antibody is commonly used in studies involving nucleic acids and can be used to detect and analyze various nucleic acid molecules. Its high specificity and sensitivity make it an essential tool for researchers working in the field of molecular biology and genetics. With its wide range of applications, the STAG2 antibody is a valuable asset for any laboratory or research facility.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RAB6C antibody, catalog no. 70R-10092</p>

<p>Mouse monoclonal RIT2 antibody</p>

Rabbit polyclonal TBC1D23 antibody

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CXorf20 antibody, catalog no. 70R-4187</p>

<p>Rabbit Polyclonal 4EBP1 antibody (Thr36)</p>

<p>LAPTM4B antibody was raised using the middle region of LAPTM4B corresponding to a region with amino acids YPNSIQEYIRQLPPNFPYRDDVMSVNPTCLVLIILLFISIILTFKGYLIS</p>

<p>The BMPR2 antibody is a polyclonal antibody that specifically targets the bone morphogenetic protein receptor 2 (BMPR2). This receptor plays a crucial role in various cellular processes, including cell growth, differentiation, and development. The BMPR2 antibody can be used in various life science research applications to study the function and regulation of this receptor.</p>

<p>This antibody reacts with heavy chains on chicken IgG (IgY) and light chains on all chicken immunoglobulins.</p>

<p>The IL8 antibody is a highly specialized monoclonal antibody that plays a crucial role in the field of Life Sciences. It is specifically designed to target and bind to interleukin-8 (IL-8), a chemokine involved in inflammation and immune response. This antibody has shown great potential in various research applications, including immunohistochemistry, where it can be used to detect IL-8 expression in tissue samples.</p>

<p>Rabbit polyclonal VEGFC antibody (FITC)</p>

<p>Rabbit polyclonal TPH2 antibody (Ser58)</p>

<p>Region of ApoA-I protein corresponding to amino acids MDEPPQSPWD RVKDLATVYV DVLKDSGRDY VSQFEGSALG KQLNLKLLDN WDSVTSTFSK LREQLGPVTQ EFWDNLEKET EGLRQEMSKD LEEVKAKVQP YLDDFQKKWQ EEMELYRQKV EPLRAELQEG ARQKLHELQE KLSPLGEEMR DRARAHVDAL RTHLAPYSDE LRQRLAARLE ALKENGGARL AEYHAKATEH LSTLSEKAKP ALEDLRQGLL PVLESFKVSF LSALEEYTKK LNTQ.</p>

<p>Purified Pig IgG (Fab'2) FITC conjugate</p>

<p>CCL28 antibody was raised in Rabbit using Human CCL28 as the immunogen</p>

<p>Purified native beta Lactoglobulin protein (Bovine)</p>

<p>Rabbit polyclonal GPR133 antibody</p>

<p>Rabbit polyclonal RPL11 antibody</p>

<p>Purified recombinant ACTA2 protein (His tag)</p>

<p>CDT1 antibody was raised in Rabbit using Human CDT1 as the immunogen</p>

<p>The TAU antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets and binds to TAU protein, which plays a crucial role in neurodegenerative diseases such as Alzheimer's disease. This antibody can be used for various applications, including research studies, diagnostic purposes, and therapeutic interventions.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NCAPD2 antibody, catalog no. 70R-5556</p>

<p>Rabbit polyclonal Radixin antibody (Thr558)</p>

<p>The DCC antibody is a powerful tool for researchers studying kinase signaling pathways. It specifically targets the kinase kinase of the mitogen-activated protein (MAP) kinase pathway, making it an essential component in understanding cellular responses to growth factors and other stimuli. The DCC antibody is available as both monoclonal and polyclonal antibodies, allowing researchers to choose the best option for their specific experiments.</p>

<p>The Smad2 antibody is a growth factor that has been extensively studied for its potential as an anticancer agent. It is a neutralizing monoclonal antibody that targets Smad2, a key protein involved in cell signaling pathways. By binding to Smad2, this antibody inhibits its function and prevents the growth and proliferation of cancer cells.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ASGR2 antibody, catalog no. 70R-1145</p>

<p>Purified recombinant Human CRYGC Protein (His tag)</p>

<p>NSE Protein is a synthetic protein that is produced using a specialized synthesis method. It has been found to have significant implications in the field of Life Sciences, particularly in the study of Proteins and Antigens. NSE Protein has shown promising results in various research areas, including its role in chemoresistance and its interaction with hybridoma cell strains.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C19orf21 antibody, catalog no. 70R-4193</p>

<p>Rabbit polyclonal 14-3-3 alpha/beta antibody (FITC)</p>

<p>Rabbit Polyclonal p56Dok2 antibody (Tyr299)</p>

<p>HAAO antibody was raised in Rabbit using Human HAAO as the immunogen</p>

<p>Rabbit polyclonal Amylin antibody (FITC)</p>

<p>Goat anti-mouse IgG (H+L) (Fab'2) (PE) was raised in goat using murine IgG whole molecule as the immunogen.</p>

LILRA2 antibody was raised in Rabbit using Human LILRA2 as the immunogen

<p>IFIH1 antibody was raised in Rabbit using Human IFIH1 as the immunogen</p>

<p>Rabbit polyclonal PFN4 antibody</p>

<p>The PRDX3 antibody is a highly specialized product in the field of Life Sciences. It is widely used in various chromatographic techniques and bioassays. This antibody specifically targets nuclear β-catenin, a protein that plays a crucial role in cell signaling and gene expression. The PRDX3 antibody is commonly employed in immunoassays to detect and quantify the levels of β-catenin in biological samples.</p>