Compuestos y reactivos bioquímicos

<p>Please enquire for more information about Melphalan mono-chloroethyl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 4-Chloro perazine-d8 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

Monascuspiloin is a potent inhibitor of kinases that has been shown to have anti-cancer properties. It inhibits the activity of kinases in urine and has been shown to inhibit the growth of cancer cells in vitro. Monascuspiloin has also been found to be effective against tumors in animal models. Additionally, it has demonstrated synergistic effects with other cancer drugs such as nintedanib and apomorphine. This analog of glimepiride induces apoptosis in human cancer cells and has been used traditionally in Chinese medicine for its medicinal properties. Overall, Monascuspiloin shows great potential as an inhibitor of kinases and a promising anti-cancer agent.

<p>D-Captopril is an analog of the drug captopril, which is used to treat hypertension and heart failure. This compound has been shown to have anticancer properties by inhibiting kinases that are involved in cancer cell growth and survival. D-Captopril has been found to induce apoptosis in human and Chinese hamster ovary cells. It also enhances the anticancer effects of chloroquine and artesunate, two drugs that are commonly used for cancer treatment. Additionally, D-Captopril has been shown to inhibit tumor growth in mice models. This compound is excreted via urine and may be a promising candidate for cancer therapy as a kinase inhibitor.</p>

<p>Please enquire for more information about (2S)-2-[[4-(5-Ethynyl-1H-pyrrolo[2,3-b]pyridin-3-yl)-2,3-dihydro-1H-indol-1-yl]carbonyl]-1-pyrrolidinecarbonitrile including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Hydantoin-5-13C,1-15N is an anticancer drug that acts as a cyclin-dependent kinase inhibitor. It is a Chinese medicinal analog that inhibits the cell cycle and induces apoptosis in cancer cells. Hydantoin-5-13C,1-15N has been shown to be effective against various types of tumors in human trials. This drug specifically targets the protein kinases involved in cell division, thereby preventing cancer cells from multiplying and spreading throughout the body. Its unique isotopic labeling enables it to be used for metabolic studies and drug discovery research. With its potent apoptotic effects and ability to inhibit cancer cell growth, Hydantoin-5-13C,1-15N represents a promising avenue for cancer treatment.</p>

Please enquire for more information about ERK-IN-3 including the price, delivery time and more detailed product information at the technical inquiry form on this page

<p>Please enquire for more information about 1-Palmitoyl-d9-2-palmitoyl-sn-glycerol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

Please enquire for more information about 8-[(6-Iodo-1,3-benzodioxol-5-yl)sulfanyl]-9-[3-(propan-2-ylamino)propyl]purin-6-amine trihydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page

<p>AK778 is a protein inhibitor that has been shown to induce apoptosis in tumor cells. It is derived from nifedipine, a calcium channel blocker used to treat hypertension and angina. AK778 has been found in Chinese urine and has been studied for its potential as an anticancer agent. This protein kinase inhibitor analog targets specific kinases involved in cancer cell growth and proliferation, making it a promising candidate for cancer treatment. Studies have shown that AK778 exhibits potent anticancer activity against human tumor cells, making it a valuable addition to the field of oncology research.</p>

<p>Please enquire for more information about Coenzyme Q10-d6 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 3,4-Diaminotoluene-d6 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about dTAGV-1-NEG including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Terameprocol is an analog of ghrelin, a hormone that regulates appetite and energy balance. It is a potent inhibitor of tumor kinase activity and has been shown to inhibit the growth of cancer cells in vitro and in vivo. Terameprocol is excreted in the urine and is not metabolized by human enzymes. This inhibitor can be used as an anticancer agent due to its ability to induce apoptosis in cancer cells. Terameprocol also inhibits the activity of kinases involved in cell proliferation, making it a promising candidate for cancer therapy. The cellulose-based formulation of terameprocol allows for targeted delivery to cancer cells while minimizing toxicity to healthy tissues.</p>

<p>Please enquire for more information about RAD51-IN-1 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Methanol-18O is a potent inhibitor of kinases, particularly those involved in cancer cell growth and proliferation. It has been shown to inhibit the activity of indirubin analogs in human urine, which suggests its potential as an anticancer treatment. Methanol-18O has also been found to induce apoptosis, or programmed cell death, in tumor cells. This unique compound may have promising applications in the development of novel kinase inhibitors for cancer therapy. Additionally, Chinese researchers have reported that methanol-18O may have potential as a protein kinase inhibitor for the treatment of various types of cancer.</p>

<p>Lovastatin-d3 is an analog of lovastatin, a medicinal compound that is commonly used as a cholesterol-lowering drug. Lovastatin-d3 has been shown to have potent anticancer properties, inhibiting the growth of cancer cells in vitro and in vivo. It acts as a protein kinase inhibitor, inducing apoptosis and inhibiting tumor growth by blocking the activity of kinases that are involved in cell division and proliferation. Lovastatin-d3 is also effective against Chinese hamster ovary cells and has been detected in urine samples from human subjects treated with lovastatin. This compound shows great promise as an anticancer agent and may be useful for the development of new cancer therapies.</p>

<p>Please enquire for more information about Elacestrant (S enantiomer) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Quinoprazine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Mouse monoclonal ILVBL antibody</p>

<p>Purified Polyclonal ATF6B antibody</p>

<p>Rabbit polyclonal POU3F1 antibody</p>

<p>Purified Polyclonal Fibulin 2 antibody</p>

<p>1-234 amino acids: MGSSHHHHHH SSGLVPRGSH MAALRYAGLD DTDSEDELPP GWEERTTKDG WVYYANHTEE KTQWEHPKTG KRKRVAGDLP YGWEQETDEN GQVFFVDHIN KRTTYLDPRL AFTVDDNPTK PTTRQRYDGS TTAMEILQGR DFTGKVVVVT GANSGIGFET AKSFALHGAH VILACRNMAR ASEAVSRILE EWQQGAATTV YCAAVPELEG LGGMYFNNCC RCMPSPEAQS EETARTLWAL SERLIQERLG SQSG</p>

<p>The MYPN antibody is a retinoid that belongs to the class of antibodies. It specifically targets 6-phosphogluconate dehydrogenase and has antinociceptive properties. This monoclonal antibody is widely used in the field of Life Sciences and has been shown to inhibit methyl transferase activity. The MYPN antibody also plays a crucial role in collagen synthesis and can be used as an inhibitor for HDAC (histone deacetylase) enzymes. It is commonly used in the development of medicines and vaccines, particularly against nuclear-related diseases. Additionally, this polyclonal antibody has been shown to enhance acetylation processes and is effective against vaccine strains.</p>

<p>Acd antibody was raised in rabbit using the c terminal of Acd as the immunogen</p>

<p>SEMA4A antibody is a protein-based product used in life sciences research. It is a polyclonal antibody that specifically targets SEMA4A, a protein involved in various cellular processes. This antibody can be used for applications such as hybridization studies, immunohistochemistry, and Western blotting to detect the presence of SEMA4A in different samples. By neutralizing SEMA4A, this antibody can provide valuable insights into the role of this protein in various biological pathways, including cell signaling, apoptosis (caspase-9 activation), and amyloid plaque formation. Researchers can use this antibody to investigate the potential therapeutic applications of targeting SEMA4A or to study its interactions with other molecules like EGFR protein or chemokines. Whether you are studying ornithine metabolism or exploring the effects of growth factors like TGF-beta, this monoclonal antibody can be a valuable tool for your research endeavors.</p>

<p>Rabbit polyclonal BDKRB1 antibody</p>

<p>Rabbit Polyclonal DPYSL4 antibody</p>

<p>ICAM4 antibody was raised in Rabbit using Human ICAM4 as the immunogen</p>

<p>The MPG antibody is a highly specialized monoclonal antibody used in Life Sciences research. It has been extensively studied for its ability to detect estradiol levels in various biological samples. This antibody specifically targets and binds to the estradiol molecule, allowing for accurate measurement and analysis.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZBTB3 antibody, catalog no. 70R-8376</p>

<p>METTL11A antibody was raised in Rabbit using Human METTL11A as the immunogen</p>

<p>DUSP22 antibody was raised in Rabbit using Human DUSP22 as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known to be the most effective rifamycin for treating tuberculosis infections. This drug works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, which prevents transcription and replication. The efficacy of this drug has been demonstrated through patch-clamp technique studies on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in cultures.</p>

<p>Purified Polyclonal CDK7 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MGAT2 antibody, catalog no. 70R-1857</p>

<p>Affinity purified Rabbit polyclonal MPP3 antibody</p>

<p>Purified Rabbit polyclonal OR5T3 antibody</p>

<p>The CD90 antibody is a highly specialized product in the field of Life Sciences. It acts as a growth factor and has been extensively studied for its potential therapeutic applications. This antibody has shown remarkable photostability, making it ideal for various experimental settings. It has also been found to interact with interferon and polymerase enzymes, further enhancing its versatility.</p>

<p>CNOT6 antibody was raised using the N terminal of CNOT6 corresponding to a region with amino acids EISGKVRSLSASLWSLTHLTALHLSDNSLSRIPSDIAKLHNLVYLDLSSN</p>

<p>Purified Polyclonal XCL2 antibody</p>

<p>The S100A8 antibody is a polyclonal antibody that is used for immobilization in various assays. It can be used to detect and measure the levels of S100A8 protein in human serum samples. The antibody is immobilized on an electrode and reacts specifically with S100A8, allowing for accurate quantification. In addition to its use in diagnostics, the S100A8 antibody can also be used as a research tool. It can be used to study the role of S100A8 in various biological processes, such as inflammation and immune response. The antibody has neutralizing properties and can inhibit the activity of reactive oxygen species and interleukins. It is also being investigated as a potential therapeutic agent for conditions such as diuretic resistance and influenza hemagglutinin inhibition. With its versatility and specificity, the S100A8 antibody is a valuable tool for researchers in the life sciences field.</p>

<p>1-100 amino acids: MSRSNRQKEY KCGDLVFAKM KGYPHWPARI DEMPEAAVKS TANKYQVFFF GTHETAFLGP KDLFPYEESK EKFGKPNKRK GFSEGLWEIE NNPTVKASGY</p>

<p>CD44 antibody was raised in Rabbit using Human CD44 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MLLT3 antibody, catalog no. 70R-8261</p>

<p>Purified Polyclonal IFN Omega antibody</p>

<p>ALS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALRGMSDLPPYGSGSSVQRQEPPISRSAKYTFYKDPRLKDATYDGRWLSG</p>

<p>Human growth hormone antibody was raised in mouse using human pituitary GH as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TCAP antibody, catalog no. 70R-1249</p>