Compuestos y reactivos bioquímicos

<p>FH antibody is a monoclonal antibody that targets the protein complex involved in the cytotoxic effects of oral haloperidol. It specifically binds to ornithine, reducing its viscosity and preventing the formation of toxic metabolites. FH antibody also interacts with the nuclear receptor, inhibiting its glycosylation and subsequent activation of interleukin-6 and interferon pathways. This monoclonal antibody has shown promising results in preclinical studies, demonstrating its potential as a therapeutic option for patients experiencing adverse effects from haloperidol treatment. Additionally, FH antibody does not interact with dopamine or mineralocorticoid receptors, minimizing the risk of unwanted side effects.</p>

<p>Mouse monoclonal Granulocytes antibody (biotin)</p>

<p>TRHR antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>NUSAP1 antibody was raised using the C terminal of NUSAP1 corresponding to a region with amino acids LKASLSRPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQ</p>

<p>SLC5A9 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rotavirus antibody was raised in mouse using p41 capsid protein of monkey, porcine and human isolates as the immunogen.</p>

<p>Rabbit polyclonal VEGFA antibody (biotin)</p>

<p>Purified Native Clostridium difficile Toxoid A protein</p>

<p>The MTHFR antibody is a monoclonal antibody used in the field of life sciences. It is designed to target and bind to the enzyme methylenetetrahydrofolate reductase (MTHFR). This antibody is commonly used in various research applications, including hybridization studies, where it can be used to detect and visualize the presence of MTHFR in biological samples.</p>

<p>Region of Leptin protein corresponding to amino acids MVPIQKVQDD TKTLIKTIVT RINDISHTQS VSSKQKVTGL DFIPGLHPIL TLSKMDQTLA VYQQILTSMP SRNVIQISND LENLRDLLHV LAFSKSCHLP WASGLETLDS LGGVLEASGY STEVVALSRL QGSLQDMLWQ LDLSPGC.</p>

<p>SIN3A antibody was raised in rabbit using the N terminal of SIN3A as the immunogen</p>

<p>SIL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KETKAEEELDAEVLEVFHPTHEWQALQPGQAVPAGSHVRLNLQTGEREAK</p>

<p>Mouse monoclonal SARS Nucleocapsid antibody</p>

<p>The Twist 1 antibody is a polyclonal antibody that has neutralizing properties against the growth factor Twist 1. This antibody specifically targets and inhibits the activity of Twist 1, a transcription factor involved in cell differentiation and embryonic development. By blocking the function of Twist 1, this antibody can prevent abnormal cell growth and promote normal cellular processes.</p>

<p>Purified Polyclonal KLK11 antibody</p>

<p>4,4'-Methylenebis(5-methyl-1H-pyrrole-2-carbaldehyde) is a ligand that binds to the GABAA receptor. It has been shown to activate this receptor by binding to the alpha subunit of the GABAAR. This receptor is responsible for mediating inhibitory signals in the brain. Activation of this receptor leads to an increase in chloride ion influx, which causes hyperpolarization of neurons and thus reduces neuronal activity. 4,4'-Methylenebis(5-methyl-1H-pyrrole-2-carbaldehyde) has also been shown to be a competitive inhibitor of peptides that bind to the GABAA receptor, such as baclofen and muscimol.<br>!--END--&gt;</p>

<p>The SIAH1 antibody is a highly specialized antibody that targets the phosphatase histidine. It exhibits cytotoxic properties and is commonly used in multidrug treatments. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific needs. It has been extensively used in various life sciences applications, including ophthalmic formulations, chemokine studies, hybridization assays, growth factor research, and immunoassays. The SIAH1 antibody is known for its high specificity and sensitivity, making it a valuable tool for scientists studying cellular signaling pathways and protein regulation. Whether you're conducting basic research or developing new therapeutic approaches, this antibody is an essential component of your toolkit.</p>

<p>CKMB antibody was raised in mouse using purified human CK-MB as the immunogen.</p>

<p>p53 antibody was raised in mouse using recombinant human p53 (transcription domain within the NH2 terminus) as the immunogen.</p>

<p>ITGB3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal UROS antibody</p>

<p>MST1R antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The SNX27 antibody is a highly effective monoclonal antibody used in Life Sciences. It is specifically designed to target thrombocytopenia, a condition characterized by low platelet count. This powerful antibody works by binding to specific receptors on the surface of platelets, promoting their activation and preventing their destruction. In addition to its role in treating thrombocytopenia, the SNX27 antibody has also shown promise in other areas of research. It can be used in assays to detect and quantify various proteins, such as collagen and anti-mesothelin antibodies. Furthermore, this antibody has been found to inhibit the activity of urokinase plasminogen activator, an enzyme involved in blood clot dissolution. With its cytotoxic properties and ability to neutralize inhibitors present in human serum, the SNX27 antibody is a valuable tool for both laboratory research and therapeutic applications.</p>

<p>EWSR1 antibody was raised in rabbit using the middle region of EWSR1 as the immunogen</p>

<p>Rabbit polyclonal VASP antibody (Ser157)</p>

<p>The NUMB antibody is a monoclonal antibody that specifically targets adiponectin, a growth factor found in adipose tissue. This antibody is widely used in Life Sciences research to study the role of adiponectin in various physiological processes. It has been shown to be effective in detecting and quantifying adiponectin levels in samples such as serum, plasma, and cell lysates. The NUMB antibody can also be used for immunohistochemistry and Western blot analysis to visualize the expression of adiponectin in different tissues. Additionally, this antibody has been used to investigate the presence of autoantibodies against adiponectin in certain diseases, including insulin resistance and diabetes. Its high specificity and sensitivity make it a valuable tool for researchers studying adipocyte biology and related disorders.</p>

<p>The RABEP1 antibody is a polyclonal antibody that has high specificity for interferon and alpha-fetoprotein. It recognizes specific glycan and fatty acid molecules and can be used in various applications in the field of Life Sciences. This monoclonal antibody exhibits high specific activity, making it a valuable tool for research purposes. It can be used to detect the presence of RABEP1 protein in samples such as human serum or cell lysates. Additionally, this antibody has been shown to have superoxide activity and may play a role in regulating lipoprotein lipase activity. With its versatility and reliability, the RABEP1 antibody is an essential component for any laboratory conducting research in these areas.</p>

<p>PGM2L1 antibody was raised using the N terminal of PGM2L1 corresponding to a region with amino acids KEDNGYKVYWETGAQITSPHDKEILKCIEECVEPWNGSWNDNLVDTSPLK</p>

<p>LPCAT1 antibody was raised using the middle region of LPCAT1 corresponding to a region with amino acids LRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEF</p>

<p>Rabbit polyclonal M3KE20 antibody</p>

<p>PIK3R4 antibody was raised using the N terminal of PIK3R4 corresponding to a region with amino acids HDLPEKAEGEPKENGLVILVSVITSCLQTLKYCDSKLAALELILHLAPRL</p>

<p>SLITRK6 antibody was raised using the N terminal of SLITRK6 corresponding to a region with amino acids NFITVIEPSAFSKLNRLKVLILNDNAIESLPPNIFRFVPLTHLDLRGNQL</p>

<p>The BCL2 antibody is a highly specialized monoclonal antibody that targets the B-cell lymphoma 2 (BCL2) protein, which plays a crucial role in regulating cell survival. This antibody specifically binds to the BCL2 protein, inhibiting its function and promoting apoptosis (cell death) in cancer cells.</p>

<p>Purified recombinant ARSM2 protein (His tag)</p>

<p>Mouse monoclonal SSR4 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DPH2 antibody, catalog no. 70R-3317</p>

<p>Rabbit polyclonal XDH antibody</p>

<p>PYGB antibody was raised using the N terminal of PYGB corresponding to a region with amino acids ADDWLRYGNPWEKARPEYMLPVHFYGRVEHTPDGVKWLDTQVVLAMPYDT</p>

<p>The Rex1 antibody is a polyclonal antibody that is widely used in life sciences research. It is commonly used in assays and immunohistochemical studies to detect the presence of Rex1, a protein expressed in pluripotent stem cells. This antibody has been shown to be highly specific and sensitive, making it an ideal tool for studying the properties and behavior of stem cells. Additionally, the Rex1 antibody can be used as an inhibitor to block the activity of Rex1, allowing researchers to investigate its function and role in cellular processes. Its application extends beyond basic research, as it has potential uses in the development of new medicines and therapies targeting pluripotent stem cells. With its unique ability to recognize and bind to Rex1, this antibody offers valuable insights into the complex mechanisms underlying cell differentiation and development.</p>

<p>The Keratin 7 antibody is a highly specialized growth factor that plays a crucial role in various biological processes. This antibody specifically targets the tyrosine residues on Keratin 7, which is a protein found in the epithelial cells of various tissues. By binding to these residues, the Keratin 7 antibody promotes cell growth and differentiation.</p>

<p>Mouse monoclonal ST13 antibody</p>

<p>QPCT antibody was raised using a synthetic peptide corresponding to a region with amino acids SRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSA</p>

<p>5-(Azepan-2-ylidene)-2,2-dimethyl-1,3-dioxane-4,6-dione is a synthetic chemical compound known for its role as a biochemical intermediate. This compound is synthesized through a controlled chemical process involving the reaction of relevant precursors under specific conditions, typically in a laboratory setting, making it an artificial construct rather than a naturally occurring substance.</p>

<p>Rabbit polyclonal SH3D19 antibody</p>

<p>The CCP2 antibody is a highly specialized and potent intracellular antibody that targets a specific growth factor. This glycopeptide antibody is designed to neutralize the activity of the growth factor, preventing its binding to receptors and subsequent signaling pathways. The CCP2 antibody is a polyclonal antibody, meaning it is derived from multiple sources and recognizes multiple epitopes on the target molecule. It is produced using state-of-the-art techniques in Life Sciences research.</p>

<p>Purified recombinant Mouse LGALS4 protein</p>

<p>MTO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids STVYAESVILTTGTFLRGMIVIGLETHPAGRLGDQPSIGLAQTLEKLGFV</p>

<p>Rabbit polyclonal PYK2 antibody (Tyr580)</p>

<p>β1-selective adrenergic receptor antagonist</p>

<p>Mouse monoclonal NPR3 antibody</p>