Compuestos y reactivos bioquímicos

<p>Mouse monoclonal NDUFA7 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TSPYL6 antibody, catalog no. 70R-1995</p>

<p>Rabbit polyclonal SLC25A2 antibody</p>

<p>Rabbit polyclonal TNPO1 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bacterial growth. This bactericidal activity is achieved by binding to DNA-dependent RNA polymerase, which prevents transcription and replication. Extensive research has been conducted on this compound using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. The oxidative metabolites of this drug undergo various metabolic transformations, including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits high affinity towards markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.</p>

<p>Rabbit polyclonal p57 Kip2 antibody (Thr310)</p>

<p>KI67 antibody was raised in rabbit using synthetic peptide derived from human Ki-67 protein as the immunogen.</p>

<p>Purified recombinant RPAIN protein (His tag)</p>

<p>Purified Rabbit polyclonal ADRB2 antibody (Ser346)</p>

<p>Purified native Minute Virus of Mice protein (Mouse)</p>

<p>ZNF322A antibody was raised in rabbit using the C terminal of ZNF322A as the immunogen</p>

<p>A lid covering the substrate 508-638 amino acids: MNEDEIQKMV RDAEANAEAD RKFEELVQTR NQGDHLLHST RKQVEEAGDK LPADDKTAIE SALTALETAL KGEDKAAIEA KMQELAQVSQ KLMEIAQQQH AQQQTAGADA SANNAKDDDV VDAEFEEVKD KK</p>

<p>Purified recombinant COMMD6 protein (His tag)</p>

<p>The p53 antibody is an extracellular antigen that specifically targets the p53 protein. This antibody is widely used in research and diagnostics to detect and quantify the presence of p53 in various samples. It can be used in immunohistochemistry, Western blotting, and ELISA assays. The p53 antibody is available as both polyclonal antibodies and monoclonal antibodies, offering researchers a range of options for their experiments. Additionally, this antibody can be used to study the role of p53 in different cellular processes, including apoptosis, cell cycle regulation, and DNA repair. With its high specificity and sensitivity, the p53 antibody is an essential tool for scientists working in life sciences and related fields.</p>

<p>Rabbit polyclonal Orosomucoid antibody (HRP)</p>

<p>The CD10 antibody is a monoclonal antibody that is used in Life Sciences research. It is commonly used as an inhibitor and immobilized to study the function and expression of CD10, also known as neprilysin. CD10 is a glycoprotein that plays a crucial role in various biological processes, including cell migration, chemokine regulation, and antigen processing.</p>

<p>TMEM158 antibody was raised using the middle region of TMEM158 corresponding to a region with amino acids AHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDLRLCVGCGWVRGRRTGR</p>

<p>The TRKB antibody is a monoclonal antibody that specifically targets the TRKB receptor, a protein involved in neurotrophic signaling. This antibody has been shown to bind to TRKB and inhibit its activation by tyrosine phosphorylation. It has also been demonstrated to block the interaction between TRKB and its ligands, such as brain-derived neurotrophic factor (BDNF). The TRKB antibody can be used in various research applications, including immunohistochemistry, Western blotting, and flow cytometry. It is particularly useful for studying the role of TRKB in neuronal development, synaptic plasticity, and neurodegenerative diseases. With its high specificity and affinity, the TRKB antibody is a valuable tool for researchers in the field of Life Sciences.</p>

<p>Rabbit polyclonal IFN beta antibody (biotin)</p>

<p>SLC22A15 antibody was raised using the middle region of SLC22A15 corresponding to a region with amino acids NQKWFGRKRTLSAFLCLGGLACLIVMFLPEKKDTGVFAVVNSHSLSLLGK</p>

<p>Purified recombinant PDZK1 protein (His tag)</p>

<p>IL9 antibody was raised using the middle region of IL9 corresponding to a region with amino acids SQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALT</p>

<p>Purified recombinant ZCCHC12 protein (His tag)</p>

<p>Mouse monoclonal VWA5A antibody</p>

<p>GAPDH antibody was raised using the middle region of GAPDH corresponding to a region with amino acids KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNC</p>

<p>The ANXA11 antibody is a monoclonal antibody that specifically targets vitronectin, a protein involved in cell adhesion and migration. It has been widely used in life sciences research to study the interaction between vitronectin and various growth factors, chemokines, and other molecules. This antibody can be used for applications such as immunohistochemistry, immunofluorescence, and Western blotting to detect the presence of vitronectin in different tissues or cell types. Additionally, the ANXA11 antibody has shown promising results in targeting antigens like epidermal growth factor (EGF), anti-mesothelin antibodies, glucagon, and cetuximab. Its specificity and high affinity make it a valuable tool for researchers in the field of molecular biology and cellular signaling.</p>

<p>IRF3 antibody was raised in mouse using recombinant human IRF-3(108-166aa) purified from E. coli as the immunogen.</p>

<p>MUC3B antibody was raised using the middle region of MUC3B corresponding to a region with amino acids KTTLKEGLQNASQDANSCQDSQTLCFKPDSIKVNNNSKTELTPEAICRRA</p>

<p>Rabbit polyclonal RNASEH1 antibody</p>

<p>Rabbit polyclonal Transaldolase antibody (HRP)</p>

<p>Rabbit polyclonal ZNF750 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication, ultimately inhibiting bacterial growth. Extensive research has shown its high efficacy in human erythrocytes using a patch-clamp technique.</p>

<p>LETMD1 antibody was raised using the middle region of LETMD1 corresponding to a region with amino acids LLRHRLKTHTTVIHQLDKALAKLGIGQLTAQEVKSACYLRGLNSTHIGED</p>

<p>Rabbit polyclonal STXBP3 antibody</p>

<p>TAPBP antibody was raised using a synthetic peptide corresponding to a region with amino acids GEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHS</p>

<p>PRKCG antibody was raised using the middle region of PRKCG corresponding to a region with amino acids WSFGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKG</p>

<p>DPPA2 antibody was raised using the N terminal of DPPA2 corresponding to a region with amino acids NMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQFTAPQKARCKIPALPL</p>

<p>OXSM antibody was raised using the middle region of OXSM corresponding to a region with amino acids HAVQRRARIYAEVLGYGLSGDAGHITAPDPEGEGALRCMAAALKDAGVQP</p>

<p>Gm13178 antibody was raised in rabbit using the C terminal of Gm13178 as the immunogen</p>

<p>CD45 antibody was raised in mouse using recombinant human CD45 (1029-1249aa) purified from E. coli as the immunogen.</p>

<p>Lidocaine antibody was raised in mouse using lidocaine conjugated to KLH as the immunogen.</p>

<p>17b-Trenbolone 17 Conjugate for use in immunoassays</p>

<p>PHF10 antibody was raised using the middle region of PHF10 corresponding to a region with amino acids PELPALDSDGDSDDGEDGRGDEKRKNKGTSDSSSGNVSEGESPPDSQEDS</p>

<p>The Il33 protein is a versatile and essential component in the field of Life Sciences. It plays a crucial role in various biological processes, including cell growth, differentiation, and immune response regulation. This protein has garnered significant attention due to its potential therapeutic applications.</p>

<p>Rat thymocyte antibody was raised in rabbit using RBC-free rat thymocytes as the immunogen.</p>

<p>Mouse monoclonal MHC Class I antibody (PE)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SP1 antibody, catalog no. 70R-4097</p>

<p>ADH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLTNLCGKISNLKSPASDQQLMEDKTSRFTCKGKPVYHFFGTSTFSQYTV</p>

<p>The CD45RA antibody is a monoclonal antibody that targets the CD45RA protein, which is expressed on certain immune cells. It has been shown to be effective in inhibiting the growth of Corynebacterium glutamicum, a bacterium commonly used in the production of amino acids. The CD45RA antibody can also block the activity of enzymes involved in collagen degradation, leading to potential applications in the field of regenerative medicine and tissue engineering. Additionally, this antibody has been used in Life Sciences research to study various cellular processes, including substrate sirna delivery, modulation of β-catenin signaling, and phosphorylcholine metabolism. Its versatility makes it a valuable tool for scientists studying immune responses, growth factors, sugar phosphotransferase activity, and even certain pathogens like Helicobacter pylori.</p>

<p>Insulin antibody is a highly specialized antibody that plays a crucial role in regulating glucose metabolism. It is cytotoxic and can neutralize the effects of insulin by binding to it. This antibody has been widely used in research and clinical settings to study various aspects of insulin function.</p>