Compuestos y reactivos bioquímicos

<p>The MMP1 antibody is a polyclonal antibody commonly used in life sciences research. It specifically targets Matrix Metalloproteinase 1 (MMP-1), an enzyme involved in the breakdown of fibrinogen and collagen. This antibody is often used to study the role of MMP-1 in various biological processes, including cell migration, tissue remodeling, and wound healing.</p>

<p>ZNF607 antibody was raised in rabbit using the middle region of ZNF607 as the immunogen</p>

<p>Purified Polyclonal ADCK5 antibody</p>

<p>The DGKA antibody is a highly specialized immunohistochemistry product designed for Life Sciences research. It is an immobilized chemokine antibody that specifically targets and binds to CXCR4, a chemokine receptor involved in various cellular processes. This monoclonal antibody is known for its high affinity and cytotoxic effects on cells expressing CXCR4.</p>

<p>Mouse Monoclonal Peroxiredoxin 5 antibody</p>

<p>A2BP1 antibody was raised in rabbit using the N terminal of A2BP1 as the immunogen</p>

<p>The COPZ1 antibody is a highly specialized antibody that targets epidermal growth factor (EGF) and its related molecules. It belongs to the family of polyclonal antibodies, which are produced by multiple B cells and can recognize various epitopes on the target molecule. This antibody specifically binds to EGF-like proteins, such as apolipoprotein A-I (ApoA-I), and inhibits their activity.</p>

<p>Rabbit polyclonal RNF10 antibody</p>

<p>Calsyntenin 3 antibody was raised using the N terminal of CLSTN3 corresponding to a region with amino acids QICYYEILTPNTPFLIDNDGNIENTEKLQYSGERLYKFTVTAYDCGKKRA</p>

<p>Purified native Canine CRP protein</p>

<p>The Yersinia pestis antibody is a highly specialized antibody used in the field of Life Sciences. It is known for its neutralizing properties, which means it can effectively block the harmful effects of Yersinia pestis, a bacterium responsible for causing the plague. The antibody works by binding to specific antigens on the surface of Yersinia pestis, triggering an antigen-antibody reaction that prevents the bacterium from infecting host cells.</p>

<p>Mouse monoclonal TCEB2 antibody</p>

<p>Mouse monoclonal ATIC antibody</p>

<p>AK3L1 antibody was raised using the N terminal of AK3L1 corresponding to a region with amino acids MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEV</p>

<p>Rabbit polyclonal 14-3-3 zeta antibody (Ser58)</p>

<p>CYP3A1 antibody was raised in rabbit using a synthetic peptide as the immunogen.</p>

<p>The MLF1 antibody is a therapeutically important protein inhibitor that targets nucleotide element binding proteins. This antibody is designed to specifically bind to MLF1, a protein involved in various cellular processes. By inhibiting the activity of MLF1, this antibody can potentially regulate gene expression and cellular functions. The MLF1 antibody is highly specific and can be used in various life science research applications. It is commonly used in studies involving protein-protein interactions, signal transduction pathways, and gene regulation. With its high affinity and specificity, this antibody offers researchers a valuable tool for understanding the role of MLF1 in cellular processes.</p>

<p>Rabbit polyclonal STARD5 antibody</p>

<p>PARD6A antibody was raised using a synthetic peptide corresponding to a region with amino acids MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVH</p>

<p>SIRT7 antibody was raised in rabbit using the middle region of SIRT7 as the immunogen</p>

<p>Purified Polyclonal TFAP2C antibody</p>

<p>Rabbit polyclonal ADORA3 antibody</p>

<p>FAM70A antibody was raised using the N terminal of FAM70A corresponding to a region with amino acids IVDGVFAARHIDLKPLYANRCHYVPKTSQKEAEEVISSSTKNSPSTRVMR</p>

<p>ZBTB26 antibody was raised in rabbit using the middle region of ZBTB26 as the immunogen</p>

<p>The PLK2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and bind to activated PLK2, a protein involved in various cellular processes. This antibody can be immobilized on an electrode for use in assays and experiments. It has been shown to have cytotoxic effects, leading to the lysis of cells when exposed to human serum. Additionally, the PLK2 antibody has antiangiogenic properties, neutralizing the activity of growth factors involved in blood vessel formation. With its high specificity and potency, this antibody is a valuable tool for studying PLK2 and its role in cellular signaling pathways.</p>

<p>The ROS antibody is a highly specialized monoclonal antibody that targets reactive oxygen species (ROS) in the body. It is commonly used in life sciences research to study the effects of ROS on various cellular processes. This antibody specifically binds to ROS, neutralizing their harmful effects and preventing oxidative damage to cells. It has been shown to inhibit the activation of TGF-beta, a key signaling molecule involved in cell growth and differentiation. Additionally, the ROS antibody can be used in combination with other antibodies such as phalloidin to visualize actin filaments and collagen in tissues. This versatile antibody is widely used in research laboratories and is an essential tool for studying oxidative stress and its impact on human health.</p>

<p>Recombinant Human IL12RB1 protein (His tag)</p>

<p>RNF186 antibody was raised using the N terminal of RNF186 corresponding to a region with amino acids MACTKTLQQSQPISAGATTTTTAVAPAGGHSGSTECDLECLVCREPYSCP</p>

<p>The Epiandrosterone antibody is a highly specialized biomolecule used in ophthalmic formulations. It is an antibody that specifically targets and binds to epiandrosterone, a hormone involved in various physiological processes. This monoclonal antibody has been extensively studied and proven to have high affinity and specificity for epiandrosterone.</p>

<p>Rabbit polyclonal DAP1 antibody (FITC)</p>

<p>Mouse monoclonal GSTO2 antibody</p>

<p>GSG1 antibody was raised using the C terminal of GSG1 corresponding to a region with amino acids VLEFKCKHSKSFKENPNCLPHHHQCFPRRLSSAAPTVGPLTSYHQYHNQP</p>

<p>Rabbit polyclonal SPG20 antibody</p>

<p>NUP98 antibody was raised using the N terminal of NUP98 corresponding to a region with amino acids EELRLEDYQANRKGPQNQVGAGTTTGLFGSSPATSSATGLFSSSTTNSGF</p>

<p>GSK3beta antibody was raised using the C terminal of GSK3B corresponding to a region with amino acids AIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNF</p>

<p>Purified recombinant ARC protein (His tag)</p>

<p>Rabbit polyclonal SIN3A antibody</p>

<p>Archain 1 antibody was raised using the middle region of ARCN1 corresponding to a region with amino acids GGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKKLFT</p>

<p>The MBP antibody is a monoclonal antibody that specifically targets the antigen known as epidermal growth factor (EGF). This antibody is widely used in Life Sciences research to study the role of EGF in various biological processes. It has been shown to have neutralizing activity against EGF, inhibiting its binding to receptors and blocking downstream signaling pathways. Additionally, the MBP antibody has been used to detect and quantify EGF levels in samples, making it a valuable tool for researchers studying growth factors and their effects. With its high specificity and affinity, this monoclonal antibody offers reliable and accurate results. It is formulated with excipients to ensure stability and long shelf life. The MBP antibody is suitable for use in various applications such as ELISA, Western blotting, immunohistochemistry, and flow cytometry.</p>

<p>The His Tag antibody is a low-molecular-weight antibody that is widely used in Life Sciences research. It specifically recognizes and binds to the histidine-tagged proteins, which are commonly used as fusion partners in recombinant protein expression systems. The structural formula of the His Tag antibody allows it to easily bind to the activated histidine residues on the target proteins.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection. This active compound works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, preventing transcription and replication. It has been extensively studied using a patch-clamp technique on human erythrocytes, demonstrating its high frequency of human activity. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>CTCF antibody was raised in Rat using Mouse CTCF-C-terminal fragment as the immunogen.</p>

<p>The Tropomyosin antibody is a highly specialized monoclonal antibody that has neutralizing, cytotoxic, and growth factor properties. It is commonly used in Life Sciences research and as an immunomodulatory agent in the development of anticancer agents. This monoclonal antibody specifically targets tropomyosin, a glycoprotein involved in cell motility and muscle contraction.</p>

<p>IFN beta antibody was raised in mouse using human interferon gamma as the immunogen.</p>

<p>PAX8 antibody was raised in mouse using recombinant Paired Box Gene 8</p>

<p>SGCB antibody was raised using a synthetic peptide corresponding to a region with amino acids FSTDYETHEFHLPSGVKSLNVQKASTERITSNATSDLNIKVDGRAIVRGN</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. The drug works by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been demonstrated through extensive testing using the patch-clamp technique on human erythrocytes. Additionally, this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it possesses the unique ability to bind to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibit their cell growth in culture.</p>

<p>YIPF1 antibody was raised using the middle region of YIPF1 corresponding to a region with amino acids HLGEKTYHYVPEFRKVSIAATIIYAYAWLVPLALWGFLMWRNSKVMNIVS</p>

<p>IL6 antibody is a monoclonal antibody that specifically targets interleukin-6 (IL-6), a cytokine involved in various inflammatory processes. This antibody has been developed as a therapeutic agent for the treatment of conditions associated with IL-6 overexpression, such as rheumatoid arthritis and certain types of cancer. IL6 antibody works by binding to IL-6 and neutralizing its activity, thereby reducing inflammation and inhibiting tumor growth. It has been shown to have high specificity and affinity for IL-6, making it an effective tool for immunoassays in Life Sciences research. Additionally, IL6 antibody can be used in vitro to measure IL-6 levels in biological samples, providing valuable insights into disease progression and response to treatment. With its unique properties and potential therapeutic applications, IL6 antibody is a valuable tool for researchers and clinicians alike.</p>

<p>PARP16 antibody was raised using a synthetic peptide corresponding to a region with amino acids KRDSVLRPFPASYARGDCKDFEALLADASKLPNLKELLQSSGDNHKRAWD</p>