Compuestos y reactivos bioquímicos

<p>Wye 672 is a potent, selective inhibitor of ATPase enzymes, which are pivotal in energy transfer and cellular processes. It is synthesized through a complex chemical process that ensures specificity and efficacy. Wye 672 functions by binding to the ATP-binding pocket of the target enzyme, thereby inhibiting its action. This mode of action disrupts the hydrolysis of ATP, a critical process in energy metabolism and signal transduction pathways.</p>

<p>DNA-PK and PI 3-K inhibitor</p>

<p>HTR3A antibody was raised in rabbit using the middle region of HTR3A as the immunogen</p>

<p>Noggin antibody was raised in rabbit using a synthetic peptide comprising an internal sequence of the human Noggin protein as the immunogen.</p>

<p>Capsiconiate is a natural compound derived from the Capsicum family of plants, specifically through the esterification of capsinoids, which are non-pungent analogs of capsaicinoids. It is derived from sources such as sweet peppers and other Capsicum varieties. Unlike its pungent counterparts, capsiconiate is characterized by its milder sensory perception while retaining significant bioactivity.</p>

<p>Psenen antibody was raised in rabbit using the N terminal of Psenen as the immunogen</p>

<p>TWEAK antibody was raised in goat using highly pure recombinant human TWEAK as the immunogen.</p>

<p>Please enquire for more information about Levulinic-d5 acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about GHRP 4 TFA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>CD38 antibody (FITC) was raised in rat using CD38 as the immunogen.</p>

<p>ALDH6A1 antibody was raised using the middle region of ALDH6A1 corresponding to a region with amino acids AVLVGEAKKWLPELVEHAKNLRVNAGDQPGADLGPLITPQAKERVCNLID</p>

<p>OR13C9 antibody was raised in rabbit using the middle region of OR13C9 as the immunogen</p>

<p>Nuvenzepine is a potent and selective muscarinic antagonist, synthesized from intricate chemical processes involving non-peptidic structures. Its primary mode of action involves inhibiting muscarinic acetylcholine receptors, particularly those located in the gastrointestinal tract. By impeding these receptors, Nuvenzepine effectively reduces gastric secretions and modulates smooth muscle activity.</p>

<p>CD45R antibody (PE-CY5.5) was raised in rat using abelson murine leukemia virus-induced pre-B tumor cells as the immunogen.</p>

<p>The OR1D2 antibody is a highly specialized fibroin that exhibits cytotoxic properties. This antibody specifically targets TGF-beta, a key protein involved in various cellular processes. It also interacts with fibrinogen, a crucial protein for blood clotting. The OR1D2 antibody is available as both polyclonal and monoclonal antibodies, providing flexibility for different research needs. In addition, it has been shown to inhibit caspase-9 activity, an enzyme involved in apoptosis. Researchers in the life sciences field can utilize this antibody as a valuable tool for studying signal transduction pathways and family kinase inhibitors. Its immobilization capabilities make it ideal for binding proteins on surfaces or electrodes, facilitating various experimental setups.</p>

<p>Nicomol is a drug that belongs to the class of dextran sulfates. It is used in the treatment of cardiac disorders, including angina pectoris, congestive heart failure, and myocardial infarction. Nicomol also has hypoglycemic activity and can be useful for treating metabolic disorders. Nicomol is administered intravenously and has been shown to increase the uptake of glucose by the body, which may be due to its ability to inhibit potassium dichromate-induced protein gene expression in heart tissue. The drug also promotes mitochondrial function by increasing fatty acid oxidation and reducing fat cell size.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EIF4H antibody, catalog no. 70R-4728</p>

<p>3-Amino-4-fluorophenylpyrazole (AFPC) is a ligand that binds to the GABA receptor and activates it. AFPC also inhibits GABA transport into cells, which leads to an increase in intracellular GABA concentration. AFPC has been shown to inhibit the activity of Kainate receptors, which are involved in the transmission of pain signals. This drug has been used as a research tool to study the function of ion channels and membrane proteins such as G protein-coupled receptors, ligand-gated ion channels, and neurotransmitter transporters. It is also used as an antibody and inhibitor for various proteins, including beta 2 adrenergic receptor, type 1 adenylyl cyclase, voltage-gated potassium channels, and phospholipases A2.</p>

<p>PD 173212 is a drug that is used to regulate the activity of neurons in the geniculate nucleus. It binds to glutamate receptors, which are molecules located on the surface of cells. This binding prevents the release of neurotransmitters and blocks synaptic transmission, thereby reducing pain. PD 173212 has also been shown to block calcium channels, which are channels for ions in cell membranes. The inhibition of these channels reduces neuronal excitability and may be responsible for its analgesic properties.</p>

<p>CD45R antibody (FITC) was raised in rat using abelson murine leukemia virus-induced pre-B tumor cells as the immunogen.</p>

<p>Inhibitor of tankyrase</p>

<p>The P54 antibody is a highly specialized protein that belongs to the family of kinase inhibitors. It is commonly used in Life Sciences research and has shown promising results in various studies. This polyclonal antibody specifically binds to proteins involved in the regulation of cell growth, such as epidermal growth factor (EGF) and androgen receptors.</p>

<p>4-Amino-3-ethoxybenzenesulfonic acid is a research tool that is used to study ion channels. It activates the receptor, which leads to increased cell permeability and the release of neurotransmitters. 4-Amino-3-ethoxybenzenesulfonic acid can be used to determine the effects of a ligand on a receptor by binding to it and altering its activity. 4-Amino-3-ethoxybenzenesulfonic acid is also used as an antibody in immunohistochemistry studies and has been shown to inhibit protein interactions.</p>

<p>Glucokinase activator 1 (GKA1) is a protein that activates glucokinase, which is an enzyme that promotes the phosphorylation of glucose to glucose-6-phosphate. GKA1 has been shown to activate glucokinase in a mutant strain of E. coli, which has been shown to have increased lipoprotein lipase activity and enhanced uptake of glucose. This protein is also able to stimulate the production of insulin by increasing transcriptional regulation and messenger RNA levels. GKA1 may be used as a potential therapy for diabetes and as a diagnostic tool for measuring insulin resistance.</p>

<p>CD56 antibody (Spectral Red) was raised in mouse using human CD56 as the immunogen.</p>

<p>Rat monoclonal 41BB Ligand antibody (PE)</p>

<p>FAK antibody was raised in Mouse using a purified recombinant fragment of human FAK expressed in E. coli as the immunogen.</p>

<p>NANP antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KLHL8 antibody, catalog no. 70R-8348</p>

<p>Olinciguat is a soluble guanylate cyclase stimulator that increases the level of intracellular cGMP. Olinciguat is used to treat pulmonary arterial hypertension, which is characterized by excessive vasoconstriction in the lungs. Olinciguat has been shown to increase the levels of prostacyclin and decrease the levels of thromboxane A2, thereby reducing inflammation and increasing blood flow to the lungs. Olinciguat also has been shown to reduce blood pressure and improve eye disorders, such as glaucoma.</p>

<p>Viral RNA Lysis Buffer is a reagent used for the preparation of viral RNA from cell culture, tissue, and blood samples. It contains a mixture of dodecyl trimethyl ammonium bromide (DTAB) and sodium deoxycholate (DOC), which are detergents that disrupt the lipid bilayer of cells. The virus lysis buffer also contains guanidine isothiocyanate (GTC), which aids in the solubilization of nucleic acids. The reagent is supplied as a powder in an inert container with a desiccant pouch to maintain stability and prevent contamination. Viral RNA Lysis Buffer can be reconstituted easily with water or other liquids, such as alcohol or buffer solutions, to form a solution that can be stored at room temperature for up to 3 months.</p>

<p>Mouse monoclonal EPSP synthase antibody</p>

<p>CD11a antibody (Azide Free) was raised in rat using murine CD11a (LFA-1a) as the immunogen.</p>

<p>Big Endothelin-3 (Rat, 1-41 Amide) is a precursor molecule of the Endothelin-3 (ET-3) peptide, that belongs to the large family of endothelin peptides which activate the G-protein coupled receptors ETA and ETB. However ET-3 has lower affinity for the ETA receptors compared to Endothelin-1 (ET-1) and Endothelin-2 (ET-2), whereas all three endothelins have similar affinity for ETB receptors. As ETB receptors make up around 90% of the endothelin receptors found in the cerebral cortex in humans, ET-3 can be nicknamed the ‘brain endothelin’. Also through ET-3’s activation of ETB receptors, ET-3 is involved in the development of the enteric nervous system which controls within the gut, blood flow, secretion and intestinal motility. This product has disulfide bonds between Cys1-Cys15 and Cys3-Cys11 and is available as a 0.1mg vial.</p>

<p>Rabbit polyclonal alpha Synuclein antibody (Tyr136)</p>

<p>3-Methylsulfonylamino-1-methyl-4(1H)-quinolone is a cardiac stimulant that increases the force of contraction of the heart by binding to and activating cardiac L type voltage sensitive calcium channels. It has been shown to increase the rate and contractility of atria and ventricles, as well as increasing blood pressure. 3-Methylsulfonylamino-1-methyl-4(1H)-quinolone has also been shown to have cellular electrophysiological properties in cardiac muscle cells. This drug is orally active and has a half life of 10 hours.</p>

<p>RTCD1 antibody was raised using the N terminal of RTCD1 corresponding to a region with amino acids VQKIRAGRSTPGLRPQHLSGLEMIRDLCDGQLEGAEIGSTEITFTPEKIK</p>

<p>Soporidine is an inhibitor of protein interactions, which is used in the study of receptor-ligand interactions. Soporidine has been shown to activate some receptors and inhibit others. It has also been shown to be a potent inhibitor of ion channels and may be useful as a research tool for studying ion channel function.</p>

<p>Please enquire for more information about CORM-3 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Purified Rabbit polyclonal CD32 antibody (Tyr292)</p>

<p>GCOM1 antibody was raised using the middle region of Gcom1 corresponding to a region with amino acids VAQVENQLLKMKVESSQEANAEVMREMTKKLYSQYEEKLQEEQRKHSAEK</p>

<p>Bch-research bc368502 is a peptide inhibitor of the protein interactions between C-terminal Src kinase (Csk) and Bruton's tyrosine kinase (Btk). It is a research tool for studying protein interactions, activator or ligand, receptor, ion channels, and antibody. Bch-research bc368502 is a high purity product with CAS No. 1292568-63-8.</p>

<p>Alternaria alternata produces a toxin called AAL toxin TD2. This toxin binds to the erythrocyte membrane, thereby inhibiting oxygen uptake.</p>

<p>The Elastin antibody is a neutralizing inhibitor that is widely used in Life Sciences research. It specifically targets protein kinases involved in the regulation of TGF-beta signaling pathway, P2X receptors, and collagen synthesis. This antibody has been shown to effectively block the activation of these proteins, preventing the downstream effects such as proton release, superoxide production, and chemokine secretion. Additionally, the Elastin antibody is commonly used for immunohistochemistry and immunofluorescence experiments to detect elastin expression in various tissues and cell types. It is a polyclonal antibody derived from animals and exhibits high specificity and sensitivity. Researchers often rely on this antibody to study the role of elastin in various biological processes and its potential as a therapeutic target for conditions related to mesenchymal stem cells dysfunction.</p>

<p>RNF139 antibody was raised using the N terminal of RNF139 corresponding to a region with amino acids SQRSLFKFYTYSSAFLLAATSVLVNYYASLHIDFYGAYNTSAFGIELLPR</p>

<p>TGF b 1 is a member of the transforming growth factor family and is a potent inhibitor of cell proliferation. Recombinant human TGF b 1 has been shown to inhibit the proliferation of various cell types in culture, including fibroblasts, endothelial cells, and smooth muscle cells. It also inhibits tumor growth in vivo. The binding site for TGF b 1 on target cells has been localized to the extracellular domain of type II receptor kinase, which is composed of three immunoglobulin-like domains. This protein can be used as an antibody or ligand to study protein interactions.</p>

<p>Please enquire for more information about 2-Dibromomethyl-benzonitrile including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Rabbit polyclonal GPR27 antibody</p>

<p>Mouse anti-goat IgG (H + L) (HRP) was raised in mouse using goat IgG (H &amp; L) as the immunogen.</p>

<p>Purified Polyclonal GUCY1B3 antibody</p>