Compuestos y reactivos bioquímicos

<p>LRRC24 antibody was raised using the N terminal of LRRC24 corresponding to a region with amino acids HLPRLQELHLQENSIELLEDQALAGLSSLALLDLSRNQLGTISREALQPL</p>

<p>The MAGE antibody is a low-molecular-weight antiviral agent that is used to detect specific proteins in blood plasma. It belongs to the class of Monoclonal Antibodies, which are highly specific antibodies produced by identical immune cells. The MAGE antibody can be used in various applications, including syncytia formation assays and detection of specific proteins in diagnostic tests.</p>

<p>Abca1 antibody was raised in rabbit using the middle region of Abca1 as the immunogen</p>

<p>The GAPDH antibody is a highly specific monoclonal antibody that targets glyceraldehyde-3-phosphate dehydrogenase (GAPDH). This antibody is widely used in life sciences research to detect and quantify GAPDH levels in various samples, including blood plasma and isolated nucleic acids.</p>

<p>Mouse Red Blood Cells are a valuable resource in various research applications. These cells play a crucial role in studying the effects of different factors on cell growth and development. Mouse Red Blood Cells contain important molecules such as dopamine, growth factors, necrosis factor-related apoptosis-inducing ligands, and chemokines that are involved in various biological processes. One of the key characteristics of Mouse Red Blood Cells is their ability to induce hemolysis. This property makes them ideal for studying the effects of different substances on cell membrane integrity and function. Additionally, Mouse Red Blood Cells have been used in veterinary applications to study the anti-vascular endothelial growth factor (anti-VEGF) activity of certain compounds. Researchers have also utilized Mouse Red Blood Cells to investigate the potential therapeutic properties of monoclonal antibodies like adalimumab. These antibodies have shown antiangiogenic effects, making them promising candidates for treating various diseases. Furthermore, Mouse Red Blood Cells can be used to study protein kinase inhibitors and their impact on</p>

<p>The FYN antibody is a monoclonal antibody that specifically targets the glial fibrillary acidic protein (GFAP). It is commonly used in research and diagnostic applications to detect and study GFAP expression. GFAP is an intermediate filament protein that is highly expressed in astrocytes, a type of glial cell in the central nervous system. The FYN antibody can be used to visualize and quantify GFAP levels in various tissues and cell types, providing valuable insights into the role of astrocytes in neurological diseases and disorders.</p>

<p>Factor X antibody is a polyclonal antibody that specifically targets Factor X, an essential protein involved in the blood clotting cascade. This antibody is derived from adeno-associated virus and has been shown to have high affinity and specificity for Factor X. It can be used in various life science applications, such as research studies on blood coagulation, as well as in the development of anti-neoplastic agents with antiangiogenic activity. Additionally, this antibody has been found to inhibit lipid peroxidation, which may have implications in preventing oxidative damage. With its unique properties and potential therapeutic applications, Factor X antibody is a valuable tool for researchers and clinicians alike.</p>

<p>AChE antibody was raised in mouse using purified human cerebellar acetylcholinesterase as the immunogen.</p>

<p>NUDC antibody was raised using a synthetic peptide corresponding to a region with amino acids DAENHEAQLKNGSLDSPGKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYR</p>

<p>The HES1 antibody is a highly specific monoclonal antibody used in Life Sciences research. It targets the HES1 protein, which plays a crucial role in various cellular processes such as cell differentiation and proliferation. This antibody is commonly utilized in studies involving collagen, alpha-fetoprotein, helicobacter, androgen, annexin, and epidermal growth factor.</p>

<p>STK38 antibody was raised using the C terminal of STK38 corresponding to a region with amino acids IGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESD</p>

<p>Claudin 19 antibody was raised using the C terminal of CLDN19 corresponding to a region with amino acids AVLGGSFLCCTCPEPERPNSSPQPYRPGPSAAAREPVVKLPASAKGPLGV</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HYAL1 antibody, catalog no. 70R-9002</p>

<p>Mouse monoclonal TCP11L2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ARGFX antibody, catalog no. 70R-8696</p>

<p>TRIM36 antibody was raised using the middle region of TRIM36 corresponding to a region with amino acids GYIMELIAKGKASAMGLQQTHEHSRLTSKGGEARCPFEISEVGKQSLPRR</p>

<p>The Calponin antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of Monoclonal Antibodies and is designed for use in human serum. This antibody is specifically designed to target and bind to calponin, a protein involved in various cellular processes.</p>

<p>Mouse monoclonal CD20 antibody (biotin)</p>

<p>HAV VP1 antibody is a monoclonal antibody that specifically targets the HAV VP1 protein. This antibody can be used in various applications, including immunoassays and protein detection. The HAV VP1 antibody is highly specific and exhibits strong binding affinity to the target protein, ensuring accurate and reliable results.</p>

<p>TNF alpha antibody was raised in rabbit using highly pure recombinant murine TNF-alpha as the immunogen.</p>

<p>C9ORF4 antibody was raised using the middle region of C9Orf4 corresponding to a region with amino acids HDDNGRVRIQHFYNVGQWAKEIQRNPARDEEGVFENNRVTCRFKRPVNVP</p>

<p>WDR55 antibody was raised using the middle region of WDR55 corresponding to a region with amino acids AKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLTSVTLMKWGKKVACG</p>

<p>Rabbit polyclonal VEGFR2 antibody (Tyr1054)</p>

<p>The Histone H1 antibody is a powerful tool used in Life Sciences research. This monoclonal antibody specifically targets and neutralizes histone H1, an important protein involved in chromatin structure and gene regulation. It has been extensively tested and validated for use in various applications, including Western blotting, immunohistochemistry, and immunofluorescence.</p>

<p>06:0-06:0 NBD pc is a mouse monoclonal antibody that recognizes the extracellular domain of the human protein, calcitonin receptor-like receptor (CLR). CLR is a GPCR that is activated by calcitonin and mediates Ca2+ signaling. 06:0-06:0 NBD pc has been used to study protein interactions, ion channels, and cell biology. 06:0-06:0 NBD pc has also been used as a research tool in pharmacology and life sciences.</p>

<p>EVX2 antibody was raised in rabbit using the middle region of EVX2 as the immunogen</p>

<p>PPM1K antibody was raised using a synthetic peptide corresponding to a region with amino acids AHAVTEQAIQYGTEDNSTAVVVPFGAWGKYKNSEINFSFSRSFASSGRWA</p>

<p>SLC22A12 antibody was raised using a synthetic peptide corresponding to a region with amino acids SMLENFSAAVPSHRCWAPLLDNSTAQASILGSLSPEALLAISIPPGPNQR</p>

<p>The Influenza B antibody is a hormone peptide that possesses antiviral properties. It is widely used in the field of Life Sciences to study various aspects of influenza infection. This antibody specifically targets and neutralizes the Influenza B virus, preventing its replication and spread within the body. It has been extensively studied for its ability to inhibit the activity of autoantibodies and other immune factors associated with viral infections.</p>

<p>Region of IL11 protein corresponding to amino acids MPGPPPGPPR VSPDPRAELD STVLLTRSLL ADTRQLAAQL RDKFPADGDH NLDSLPTLAM SAGALGALQL PGVLTRLRAD LLSYLRHVQW LRRAGGSSLK TLEPELGTLQ ARLDRLLRRL QLLMSRLALP QPPPDPPAPP LAPPSSAWGG IRAAHAILGG LHLTLDWAVR GLLLLKTRL.</p>

<p>Streptavidin protein is a glycoprotein commonly used in Life Sciences research. It has a high affinity for biotin, making it an ideal tool for various applications such as immunohistochemistry, Western blotting, and protein purification. Streptavidin protein is often used in conjunction with biotinylated monoclonal antibodies to detect specific biomolecules in samples.</p>

<p>Mouse monoclonal SLFNL1 antibody</p>

<p>SDCBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQ</p>

<p>Rabbit polyclonal TCP10 antibody</p>

<p>Rhodopsin antibody is a monoclonal antibody that specifically targets and binds to rhodopsin, an important protein involved in vision. This antibody has been extensively studied and shown to have a high affinity for rhodopsin, making it an effective tool for research and diagnostics. It can be used in various applications, such as immunohistochemistry, where it helps visualize the distribution and localization of rhodopsin in tissues. Additionally, this antibody has neutralizing properties, meaning it can block the activity of rhodopsin and inhibit its function. This makes it a valuable tool for studying the role of rhodopsin in various biological processes. Whether you're conducting research in Life Sciences or working on diagnostic applications, this rhodopsin antibody is a reliable choice that delivers accurate and reproducible results.</p>

<p>Mouse monoclonal CTDSP1 antibody</p>

<p>Rabbit polyclonal SAR1B antibody</p>

<p>IFN Gamma R2 antibody was raised using a synthetic peptide corresponding to a region with amino acids WEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHL</p>

<p>Rabbit polyclonal PLCXD1 antibody</p>

<p>SMAD4 antibody was raised in Mouse using a purified recombinant fragment of human SMAD4 expressed in E. coli as the immunogen.</p>

<p>MTUS1 antibody was raised using the middle region of MTUS1 corresponding to a region with amino acids KRLSMENEELLWKLHNGDLCSPKRSPTSSAIPLQSPRNSGSFPSPSISPR</p>

<p>The Cyclin D1 antibody is a highly specialized Polyclonal Antibody used in immunoassays within the Life Sciences field. It specifically targets endothelial growth factors, such as fibronectin and collagen, to provide accurate and reliable results. This antibody is available in both polyclonal and monoclonal forms, giving researchers the flexibility to choose the best option for their experiments.</p>

<p>The NGAL antibody is a monoclonal antibody that specifically targets and binds to activated human serum. It has been extensively studied in the field of Life Sciences for its potential therapeutic applications. The NGAL antibody has shown promising results in inhibiting the activity of sclerostin, a protein involved in bone metabolism. Additionally, it has been found to bind to nuclear antigens and collagen, making it a valuable tool for research in various areas such as immunology and oncology. The NGAL antibody also exhibits cytotoxic effects, making it suitable for antibody-drug conjugate (ADC) development. With its high specificity and versatility, the NGAL antibody is an essential component in the arsenal of researchers and scientists working towards advancements in medical science.</p>

<p>Mouse monoclonal SAFB1 antibody</p>

<p>Purified recombinant RNF34 protein (His tag)</p>

<p>Negative control for CM11; no effect on VHL E3 ubiquitin ligase</p>

<p>CANT1 antibody was raised in Rabbit using Human CANT1 as the immunogen</p>

<p>The CAV1 antibody is a growth factor that has multidrug and interferon properties. It is widely used in the field of Life Sciences for its neuroprotective effects. This antibody specifically targets vasoactive intestinal peptide (VIP) binding proteins, which play a crucial role in various cellular processes. The CAV1 antibody can be used in research studies to detect and measure the levels of VIP binding proteins in samples. It is available as both polyclonal and monoclonal antibodies, providing researchers with options based on their specific needs. The low-molecular-weight nature of this antibody allows for efficient penetration into cells, ensuring accurate detection and analysis. Additionally, the CAV1 antibody has been shown to possess neutralizing activity against certain factors, making it a valuable tool in various experimental settings. Researchers can rely on the high-quality performance of this antibody to obtain reliable and reproducible results for their studies.</p>

<p>KIF4A antibody was raised in Rabbit using Human KIF4A as the immunogen</p>

<p>The HDAC3 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and detect HDAC3, a protein involved in various cellular processes. This antibody has been extensively validated and proven to be highly specific and sensitive in detecting HDAC3 levels.</p>