Compuestos y reactivos bioquímicos

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BAT5 antibody, catalog no. 70R-6903</p>

<p>CCNB2 antibody was raised in Rabbit using Human CCNB2 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal DAP5 antibody</p>

<p>BCL11A antibody was raised in rabbit using the N terminal of BCL11A as the immunogen</p>

<p>Rabbit polyclonal AIRE antibody (Ser156)</p>

<p>Rabbit polyclonal TMEM30C antibody</p>

<p>CDSN antibody was raised in Rabbit using Human CDSN as the immunogen</p>

<p>Goat anti-Bovine IgG (H + L) (FITC) was raised in goat using purified Bovine IgG (H&amp;L) as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TJP2 antibody, catalog no. 70R-2655</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RBMS2 antibody, catalog no. 70R-4740</p>

<p>GNPDA1 antibody was raised using the C terminal of GNPDA1 corresponding to a region with amino acids EGVNHMWTVSAFQQHPRTVFVCDEDATLELKVKTVKYFKGLMLVHNKLVD</p>

<p>Purified Polyclonal RAB31 antibody</p>

<p>The PGRMC1 antibody is a highly specialized antibody that targets the epidermal growth factor receptor. It has been shown to have neutralizing effects on the growth and proliferation of cancer cells, particularly in breast cancer cell lines such as MCF-7. This monoclonal antibody is widely used in life sciences research and has been proven effective in studies involving human hepatocytes and various carcinoma cell lines. Additionally, it has been used in polymerase chain reaction (PCR) experiments to detect the presence of PGRMC1 mRNA. The PGRMC1 antibody also plays a crucial role in cardiac muscle troponin regulation and has been found to interact with fatty acids and drugs like pioglitazone. With its high specificity and efficacy, this polyclonal antibody is an essential tool for researchers in the field of molecular biology and biomedical science.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C2orf25 antibody, catalog no. 70R-4055</p>

<p>ZKSCAN1 antibody was raised in rabbit using the N terminal of ZKSCAN1 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal DRD3 antibody</p>

<p>The DLC8 antibody is a specialized Polyclonal Antibody commonly used in Life Sciences research. It targets the circumsporozoite protein, a nuclear protein involved in various cellular processes. This antibody has been extensively tested and found to have high specificity and affinity for its target.</p>

<p>RPL10A antibody was raised using the N terminal of RPL10A corresponding to a region with amino acids MSSKVSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKNYDPQKDKRFS</p>

<p>EEF2K antibody was raised in Rabbit using Human EEF2K as the immunogen</p>

<p>The HA Tag antibody is a highly efficient and potent inhibitor used in drug preparation. This monoclonal antibody specifically targets the human serum protein known as HA (hemagglutinin). It is widely used in various applications, including cytometry analysis, electrochemical impedance spectroscopy, and life sciences research.</p>

<p>MDC antibody was raised in mouse using highly pure recombinant human MDC as the immunogen.</p>

<p>XYLT1 antibody was raised in rabbit using the middle region of XYLT1 as the immunogen</p>

<p>Rabbit polyclonal FOS antibody (Thr232)</p>

<p>EGFR antibody was raised in rabbit using a synthetic peptide corresponding to a region near the carboxy terminus which is identical in human, mouse and rat EGFR, as the immunogen.</p>

<p>GTF2F1 antibody was raised in Rabbit using Human GTF2F1 as the immunogen</p>

<p>CA13 antibody was raised in Rabbit using Human CA13 as the immunogen</p>

<p>FKBP14 antibody was raised in Rabbit using Human FKBP14 as the immunogen</p>

<p>Galectin 8 antibody is a monoclonal antibody used in Life Sciences research. It plays a crucial role in various biological processes such as electrode signaling and fas-mediated apoptosis. This antibody specifically targets galectin 8, a protein involved in lipoprotein lipase activity and glycation processes. Galectin 8 antibody can be used for various applications, including antiviral studies, detection of glycosylation patterns, and analysis of interferon signaling pathways. It is available as both monoclonal and polyclonal antibodies, providing researchers with versatile options for their experiments. With its high specificity and sensitivity, Galectin 8 antibody is an essential tool for studying the functions and interactions of this important protein in different cellular processes.</p>

<p>MCM3 antibody was raised in Rabbit using Human MCM3 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PSMB9 antibody, catalog no. 70R-5740</p>

<p>Rabbit polyclonal TUBGCP4 antibody</p>

<p>The hnRNP A1 Antibody is a highly specialized Monoclonal Antibody that is widely used in the field of Life Sciences. It plays a crucial role in various cellular processes, including RNA metabolism and regulation. This antibody specifically targets hnRNP A1, a protein involved in mRNA splicing and transport.</p>

<p>Please enquire for more information about Tyr-Pro TFA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ACT-709478 is an orally bioavailable, non-peptide small molecule for the treatment of epileptic patients. It has a pharmacokinetic half-life of about 4 hours and penetrates the blood–brain barrier. ACT-709478 has been shown to be effective in animal models of cardiovascular diseases. The drug is metabolized by cytochrome P450 enzymes and has functional groups that are not well characterized. The terminal half-life of this molecule is about 2 hours.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Slc6a9 antibody, catalog no. 70R-8535</p>

<p>EIF1AY antibody was raised in Rabbit using Human EIF1AY as the immunogen</p>

<p>Purified Polyclonal CTDSP1 antibody</p>

<p>1-245 amino acids: MEKTELIQKA KLAEQAERYD DMATCMKAVT EQGAELSNEE RNLLSVAYKN VVGGRRSAWR VISSIEQKTD TSDKKLQLIK DYREKVESEL RSICTTVLEL LDKYLIANAT NPESKVFYLK MKGDYFRYLA EVACGDDRKQ TIDNSQGAYQ EAFDISKKEM QPTHPIRLGL ALNFSVFYYE ILNNPELACT LAKTAFDEAI AELDTLNEDS YKDSTLIMQL LRDNLTLWTS DSAGEECDAA EGAEN</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IRX3 antibody, catalog no. 70R-8549</p>

<p>The BRAF antibody is a neuroprotective globulin that belongs to the class of glycosylated monoclonal antibodies. It has been specifically designed to target and inhibit the activity of BRAF, a protein involved in various cellular processes. This antibody has shown inhibitory effects on factors such as alpha-fetoprotein and chemokines, making it a valuable tool for researchers in the field of Life Sciences. The BRAF antibody is available in both polyclonal and monoclonal forms, providing options for different experimental needs. It is formulated with excipients to ensure stability and efficacy. Additionally, this antibody has neutralizing properties against IFN-gamma, further expanding its potential applications. With its unique characteristics and versatile nature, the BRAF antibody offers promising opportunities for scientific investigations and therapeutic developments.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KLHDC3 antibody, catalog no. 70R-9181</p>

<p>Rabbit polyclonal NMDAR2B antibody (Tyr1336)</p>

<p>The PAK1 antibody is a highly specific antibody used in the field of Life Sciences. It is capable of recognizing and binding to the amino-terminal and carboxyl terminal regions of PAK1, a protein involved in various cellular processes. This antibody can be utilized for a wide range of applications, including immunoassays, Western blotting, immunohistochemistry, and more.</p>

<p>MMP10 antibody was raised in rabbit using the N terminal of MMP10 as the immunogen</p>

<p>Chlamydia antibody was raised in mouse using Chlamydia antigen as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of XTP3TPA antibody, catalog no. 70R-1225</p>

<p>PCNA antibody was raised in rabbit using the C terminal of PCNA as the immunogen</p>

<p>CHCHD3 antibody was raised using the middle region of CHCHD3 corresponding to a region with amino acids LRERICSEEERAKAKHLARQLEEKDRVLKKQDAFYKEQLARLEERSSEFY</p>

<p>RALB antibody was raised using a synthetic peptide corresponding to a region with amino acids FREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVE</p>

<p>Rabbit polyclonal Histone H3 antibody (Thr3)</p>