Compuestos y reactivos bioquímicos

<p>Purified recombinant LRRC59 protein (His tag)</p>

<p>Halofuginone Conjugate for use in immunoassays</p>

<p>Mouse monoclonal POLR2E antibody</p>

<p>DPF1 antibody was raised in rabbit using the middle region of DPF1 as the immunogen</p>

<p>Rabbit polyclonal SAMD4A antibody</p>

<p>Purified Polyclonal ZO3 antibody</p>

<p>VZV gpl antibody was raised in mouse using varicella zoster virus HZ strain as the immunogen.</p>

<p>IL2 antibody was raised in Mouse using recombinant human IL-2 as the immunogen.</p>

<p>ACOT11 antibody was raised using the middle region of ACOT11 corresponding to a region with amino acids AEKTRVESVELVLPPHANHQGNTFGGQIMAWMENVATIAASRLCRAHPTL</p>

<p>Rabbit Polyclonal GRK2 antibody (Ser29)</p>

<p>Goat anti-Mouse IgG + IgM (HRP) was raised in goat using purified Mouse IgG + IgM as the immunogen.</p>

<p>Rabbit polyclonal BTF3L3 antibody</p>

<p>Rabbit polyclonal MNK1 antibody</p>

<p>RC3H2 antibody was raised using the middle region of RC3H2 corresponding to a region with amino acids YSRKGHETPQPQPNSKYKTSMCRDLRQQGGCPRGTNCTFAHSQEELEKYR</p>

<p>ALS2CR12 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSKLTPLVPAPKNHNYLQPTKPVVSPKMKIHSARQEETNKSFYEVINVSP</p>

<p>Mouse monoclonal DNTTIP1 antibody</p>

<p>VU 0361737 is a small molecule that has been shown to have anti-inflammatory properties. It binds to glutamate receptors, which are involved in the regulation of inflammatory responses and pain. VU 0361737 also blocks microglia activation, prevents glutamate toxicity, and inhibits tumor progression in a mouse model of melanoma. It was also found to be neuroprotective against glutamate-induced neurotoxicity in primary hippocampal neurons and cerebellar granule cells. The molecular mode of action of VU 0361737 is not completely understood, but it may be due to its ability to block the adenosine receptor A2A signaling pathway.</p>

<p>Rabbit polyclonal XPNPEP3 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. Extensive studies have shown its high efficacy in human erythrocytes using a patch-clamp technique.</p>

<p>IL1b antibody is a monoclonal antibody that specifically targets and neutralizes interleukin-1 beta (IL-1β), a pro-inflammatory cytokine involved in various biological processes. IL-1β plays a crucial role in the regulation of immune responses, cell growth, and differentiation. This antibody has been extensively used in research and life sciences to study the function of IL-1β and its inhibitors.</p>

<p>SRD5A2 antibody was raised using the N terminal of SRD5A2 corresponding to a region with amino acids MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR</p>

<p>The CDK5 antibody is a highly specialized monoclonal antibody that has neutralizing properties against cyclin-dependent kinase 5 (CDK5). CDK5 is an enzyme involved in various cellular processes, including cell cycle regulation and neuronal development. The CDK5 antibody acts as an inhibitor of CDK5 activity, leading to cytotoxic effects on targeted cells.</p>

<p>HMN-176 is a synthetic antifungal compound, which is an indolocarbazole derivative sourced from a natural alkaloid framework. This product exhibits its mode of action by inhibiting fungal cell division, specifically through interference with microtubule polymerization. This mechanism effectively disrupts the mitotic process, leading to cell cycle arrest and subsequent fungal cell death.</p>

<p>Recombinant Human RPL7A protein</p>

<p>Mouse monoclonal NME4 antibody</p>

<p>The Cytokeratin Antibody Cocktail is a powerful tool for immunohistochemistry and research applications. This cocktail contains a mixture of monoclonal antibodies that specifically target various cytokeratins, which are intermediate filament proteins found in epithelial cells. These monoclonal antibodies have been extensively validated and provide high specificity and sensitivity in detecting cytokeratin expression.</p>

<p>Purified recombinant MDS1 protein (His tag)</p>

<p>Mouse monoclonal Complement D antibody</p>

<p>Rabbit polyclonal ZNF699 antibody</p>

<p>TMTC4 antibody was raised using the N terminal of TMTC4 corresponding to a region with amino acids NKDLQAETPLGDLWHHDFWGSRLSSNTSHKSYRPLTVLTFRINYYLSGGF</p>

<p>Purified recombinant KLF7 protein (His tag)</p>

<p>The TIMM10 antibody is a polyclonal antibody that specifically targets the TIMM10 protein. This protein is located in the mitochondria and plays a crucial role in various cellular processes, including hormone and growth factor signaling, as well as β-catenin stabilization. The TIMM10 antibody binds to the amino-terminal region of the protein, allowing for its detection and analysis in biological samples.</p>

<p>Trazodone Conjugate for use in immunoassays</p>

<p>Mouse monoclonal TOMM34 antibody</p>

<p>Purified recombinant MFAP4 protein (His tag)</p>

<p>PAX6 antibody was raised in Mouse using a purified recombinant fragment of human PAX6 expressed in E. coli as the immunogen.</p>

<p>Mouse monoclonal CAPN9 antibody</p>

<p>Negative control for CM11; no effect on VHL E3 ubiquitin ligase</p>

<p>CANT1 antibody was raised in Rabbit using Human CANT1 as the immunogen</p>

<p>The CAV1 antibody is a growth factor that has multidrug and interferon properties. It is widely used in the field of Life Sciences for its neuroprotective effects. This antibody specifically targets vasoactive intestinal peptide (VIP) binding proteins, which play a crucial role in various cellular processes. The CAV1 antibody can be used in research studies to detect and measure the levels of VIP binding proteins in samples. It is available as both polyclonal and monoclonal antibodies, providing researchers with options based on their specific needs. The low-molecular-weight nature of this antibody allows for efficient penetration into cells, ensuring accurate detection and analysis. Additionally, the CAV1 antibody has been shown to possess neutralizing activity against certain factors, making it a valuable tool in various experimental settings. Researchers can rely on the high-quality performance of this antibody to obtain reliable and reproducible results for their studies.</p>

<p>KIF4A antibody was raised in Rabbit using Human KIF4A as the immunogen</p>

<p>The HDAC3 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and detect HDAC3, a protein involved in various cellular processes. This antibody has been extensively validated and proven to be highly specific and sensitive in detecting HDAC3 levels.</p>

<p>Rabbit polyclonal VAX1 antibody</p>

<p>CLAD 3 Conjugate for use in immunoassays</p>

<p>Mouse monoclonal Human Prolactin antibody (HRP)</p>

<p>ZNF511 antibody was raised in rabbit using the N terminal of ZNF511 as the immunogen</p>

<p>Mouse monoclonal PACSIN3 antibody</p>

<p>The Dopamine Receptor D1 antibody is a monoclonal antibody that specifically targets the dopamine receptor D1. It has been shown to have neutralizing properties and can be used for various applications in research and diagnostics. This antibody has been tested on different cell lines, including MCF-7 carcinoma cell lines, and has demonstrated its effectiveness in blocking the binding of dopamine to its receptor. The use of this antibody can help researchers better understand the role of dopamine receptors in various physiological processes and diseases. It can also be used in immunoassays, such as ELISA or Western blotting, to detect the presence of dopamine receptor D1 in biological samples. With its high specificity and sensitivity, this antibody is a valuable tool for studying dopamine signaling pathways and exploring potential therapeutic interventions targeting this receptor.</p>

<p>PINX1 antibody was raised using the N terminal of PINX1 corresponding to a region with amino acids EKMGWSKGKGLGAQEQGATDHIKVQVKNNHLGLGATINNEDNWIAHQDDF</p>

<p>Frizzled antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>