Compuestos y reactivos bioquímicos

<p>Purified recombinant UGT8 protein (His tag)</p>

<p>VPS4A antibody was raised using a synthetic peptide corresponding to a region with amino acids LRSKEKHGKKPVKENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVMEKPN</p>

<p>Recombinant human IL-6</p>

<p>The Nuclear Pore Complex antibody is a highly specific monoclonal antibody designed for use in Life Sciences research. It is used to detect and study the nuclear pore complex, a structure that regulates the transport of molecules between the nucleus and cytoplasm. This antibody binds specifically to proteins within the nuclear pore complex, allowing researchers to visualize and study its function.</p>

<p>Rabbit polyclonal TSPAN7 antibody</p>

<p>YARS antibody was raised in mouse using recombinant Tyrosyl-Trna Synthetase (Yars)</p>

<p>TSH beta protein is a native protein that belongs to the group of proteins and antigens. It is commonly used in life sciences research, particularly in studies related to colony-stimulating factors. TSH beta protein has been shown to have various functions, including the regulation of metabolism and growth. It can interact with other molecules such as flavobacterium, glucagon, monoclonal antibodies, and inhibitors. Additionally, TSH beta protein has been found to play a role in adipose tissue function and the production of growth factors like GM-CSF (granulocyte-macrophage colony-stimulating factor). Researchers often utilize TSH beta protein in experiments involving electrodes and anti-MERTK antibodies due to its unique properties and interactions.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication, ultimately inhibiting bacterial growth.</p>

<p>Mouse monoclonal TCP11L2 antibody</p>

<p>PAFAH1B3 antibody was raised using the middle region of PAFAH1B3 corresponding to a region with amino acids GHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVN</p>

<p>Purified Rabbit polyclonal LYAR antibody</p>

<p>Mouse monoclonal OTUB2 antibody</p>

<p>PUS10 antibody was raised using the middle region of PUS10 corresponding to a region with amino acids AVFVAGRYNKYSRNLPQTPWIIDGERKLESSVEELISDHLLAVFKAESFN</p>

<p>The CD2 antibody is a monoclonal antibody that plays a crucial role in the field of Life Sciences. It interacts with CD2, a cell surface glycoprotein expressed on T cells, natural killer cells, and thymocytes. This antibody has been extensively studied for its potential applications in various areas of research.</p>

<p>Rabbit polyclonal CTCFL antibody</p>

<p>C11ORF65 antibody was raised using the N terminal Of C11Orf65 corresponding to a region with amino acids MPWKEESEFTKQDKAARVIQQAWKSFLNVAIFQHFKSLIDLRRQGEPRQI</p>

<p>PLDN antibody was raised using a synthetic peptide corresponding to a region with amino acids MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVE</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug classified under rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been proven through extensive testing using the patch-clamp technique on human erythrocytes. Metabolically, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits high affinity towards markers expressed in Mycobacterium tuberculosis strains, leading to cell growth inhibition in culture.</p>

<p>SLC39A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids HYLAQLFGLYGENGTLTAGGLARLLHSLGLGRVQGLRLGQHGPLTGRAAS</p>

<p>INSR antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>MAGEH1 antibody was raised in Rabbit using Human MAGEH1 as the immunogen</p>

<p>Mouse monoclonal TBX2 antibody</p>

<p>The ALDH3A1 antibody is a powerful tool in the field of antiviral research. It belongs to the class of Monoclonal Antibodies, which are highly specific and effective in targeting specific antigens. This antibody has been extensively studied for its ability to neutralize autoantibodies and antibodies that can cause autoimmune diseases. It has also shown promising results in combination with gemcitabine treatment, enhancing the effectiveness of this chemotherapy drug.</p>

<p>Rabbit polyclonal SLC9A8 antibody</p>

<p>Rabbit polyclonal GK3P antibody</p>

<p>HAL antibody was raised using the N terminal of HAL corresponding to a region with amino acids INKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLET</p>

<p>Rabbit Polyclonal DUSP16 antibody</p>

<p>LRRC4C antibody was raised in Rabbit using Human LRRC4C as the immunogen</p>

<p>Mouse monoclonal MAP2K4 antibody</p>

<p>The SERPINE1 antibody is a highly specialized antibody that targets the glutamate receptor. It belongs to the class of polyclonal antibodies and has been extensively studied in the field of Life Sciences. This antibody specifically interacts with β-catenin, a protein involved in cell adhesion and signaling pathways. It also inhibits the activity of colony-stimulating factors, which are important for immune response regulation. The SERPINE1 antibody has been shown to be reactive against various monoclonal antibodies, making it a versatile tool for research purposes. Additionally, it exhibits cytotoxic effects on pluripotent cells and can inhibit the activity of protein kinases, including oncogenic kinases. This monoclonal antibody is non-phosphorylated, ensuring its stability and effectiveness in experimental settings. With its wide range of applications in molecular biology and immunology research, the SERPINE1 antibody is an invaluable tool for scientists seeking to unravel complex cellular mechanisms.</p>

<p>Rabbit polyclonal RIMS3 antibody</p>

<p>ALDOC antibody was raised using the C terminal of ALDOC corresponding to a region with amino acids CPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAA</p>

<p>Mouse monoclonal PLEK antibody</p>

<p>Rabbit polyclonal PPAR gamma antibody (Ser112)</p>

<p>Rabbit polyclonal SPHK1 antibody</p>

<p>Purified recombinant JAM3 protein (His tag)</p>

<p>Rabbit polyclonal COL4A1 antibody (HRP)</p>

<p>Mouse monoclonal Myosin antibody</p>

<p>Mouse monoclonal EFNA2 antibody</p>

<p>The Keratin 18 antibody is a nanocomposite that consists of a DNA aptamer with an amino group. It can be used in Life Sciences research to study the growth factor and protein kinases involved in various cellular processes. The antibody specifically targets Keratin 18, which is a protein expressed in epithelial cells. This monoclonal antibody allows for the detection and visualization of Keratin 18 through an antigen-antibody reaction. It can be used in applications such as immunofluorescence staining, western blotting, and polymerase chain reactions (PCR). The Keratin 18 antibody is highly specific and sensitive, making it a valuable tool for researchers studying cellular biology and disease mechanisms.</p>

<p>Rabbit polyclonal GPR92 antibody</p>

<p>Purified Polyclonal MYST4 antibody</p>

<p>FSH antibody was raised in mouse using high purity intact FSH from human pituitary gland as the immunogen.</p>

<p>Haptoglobin antibody was raised against Human Haptoglobin.</p>

<p>PIGQ antibody was raised using the N terminal of PIGQ corresponding to a region with amino acids PTVLPDRQAGATTASTGGLAAVFDTVARSEVLFRSDRFDEGPVRLSHWQS</p>

<p>Mouse monoclonal NT5DC1 antibody</p>

<p>Purified recombinant HOXC11 protein (His tag)</p>

<p>Rabbit polyclonal Caspase 1 antibody (FITC)</p>

<p>Mouse monoclonal OMP28 antibody</p>

<p>Sheep polyclonal Sulphanitran antibody</p>