Compuestos y reactivos bioquímicos

<p>Goat anti-Mouse IgG + IgM (HRP) was raised in goat using purified Mouse IgG + IgM as the immunogen.</p>

<p>Rabbit polyclonal BTF3L3 antibody</p>

<p>Rabbit polyclonal MNK1 antibody</p>

<p>RC3H2 antibody was raised using the middle region of RC3H2 corresponding to a region with amino acids YSRKGHETPQPQPNSKYKTSMCRDLRQQGGCPRGTNCTFAHSQEELEKYR</p>

<p>ALS2CR12 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSKLTPLVPAPKNHNYLQPTKPVVSPKMKIHSARQEETNKSFYEVINVSP</p>

<p>Mouse monoclonal DNTTIP1 antibody</p>

<p>VU 0361737 is a small molecule that has been shown to have anti-inflammatory properties. It binds to glutamate receptors, which are involved in the regulation of inflammatory responses and pain. VU 0361737 also blocks microglia activation, prevents glutamate toxicity, and inhibits tumor progression in a mouse model of melanoma. It was also found to be neuroprotective against glutamate-induced neurotoxicity in primary hippocampal neurons and cerebellar granule cells. The molecular mode of action of VU 0361737 is not completely understood, but it may be due to its ability to block the adenosine receptor A2A signaling pathway.</p>

<p>Rabbit polyclonal XPNPEP3 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. Extensive studies have shown its high efficacy in human erythrocytes using a patch-clamp technique.</p>

<p>IL1b antibody is a monoclonal antibody that specifically targets and neutralizes interleukin-1 beta (IL-1β), a pro-inflammatory cytokine involved in various biological processes. IL-1β plays a crucial role in the regulation of immune responses, cell growth, and differentiation. This antibody has been extensively used in research and life sciences to study the function of IL-1β and its inhibitors.</p>

<p>SRD5A2 antibody was raised using the N terminal of SRD5A2 corresponding to a region with amino acids MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR</p>

<p>The CDK5 antibody is a highly specialized monoclonal antibody that has neutralizing properties against cyclin-dependent kinase 5 (CDK5). CDK5 is an enzyme involved in various cellular processes, including cell cycle regulation and neuronal development. The CDK5 antibody acts as an inhibitor of CDK5 activity, leading to cytotoxic effects on targeted cells.</p>

<p>HMN-176 is a synthetic antifungal compound, which is an indolocarbazole derivative sourced from a natural alkaloid framework. This product exhibits its mode of action by inhibiting fungal cell division, specifically through interference with microtubule polymerization. This mechanism effectively disrupts the mitotic process, leading to cell cycle arrest and subsequent fungal cell death.</p>

<p>Recombinant Human RPL7A protein</p>

<p>Mouse monoclonal NME4 antibody</p>

<p>The Cytokeratin Antibody Cocktail is a powerful tool for immunohistochemistry and research applications. This cocktail contains a mixture of monoclonal antibodies that specifically target various cytokeratins, which are intermediate filament proteins found in epithelial cells. These monoclonal antibodies have been extensively validated and provide high specificity and sensitivity in detecting cytokeratin expression.</p>

<p>Purified recombinant MDS1 protein (His tag)</p>

<p>Mouse monoclonal Complement D antibody</p>

<p>Rabbit polyclonal ZNF699 antibody</p>

<p>TMTC4 antibody was raised using the N terminal of TMTC4 corresponding to a region with amino acids NKDLQAETPLGDLWHHDFWGSRLSSNTSHKSYRPLTVLTFRINYYLSGGF</p>

<p>Purified recombinant KLF7 protein (His tag)</p>

<p>The TIMM10 antibody is a polyclonal antibody that specifically targets the TIMM10 protein. This protein is located in the mitochondria and plays a crucial role in various cellular processes, including hormone and growth factor signaling, as well as β-catenin stabilization. The TIMM10 antibody binds to the amino-terminal region of the protein, allowing for its detection and analysis in biological samples.</p>

<p>Trazodone Conjugate for use in immunoassays</p>

<p>Mouse monoclonal TOMM34 antibody</p>

<p>Purified recombinant MFAP4 protein (His tag)</p>

<p>PAX6 antibody was raised in Mouse using a purified recombinant fragment of human PAX6 expressed in E. coli as the immunogen.</p>

<p>TMEM63A antibody was raised using the N terminal of TMEM63A corresponding to a region with amino acids MDSPFLELWQSKAVSIREQLGLGDRPNDSYCYNSAKNSTVLQGVTFGGIP</p>

<p>Rabbit polyclonal S100B antibody (biotin)</p>

<p>The GATA4 antibody is a highly specialized monoclonal antibody that is used in the field of life sciences. It specifically targets the GATA4 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in detecting autoantibodies against GATA4.</p>

<p>IKAP antibody was raised in rabbit using residues 148-161 IHQDDFGESKFITV of human IKAP as the immunogen.</p>

<p>The IGF2BP2 antibody is a highly reactive and neutralizing monoclonal antibody that targets the insulin-like growth factor 2 mRNA-binding protein 2 (IGF2BP2). This antibody has been extensively studied in the field of Life Sciences and has shown great potential for therapeutic applications.</p>

<p>The Aprotinin antibody is a highly specialized and effective tool in the field of Life Sciences. It is a monoclonal antibody that has been developed for use in bioassays, specifically targeting the adeno-associated virus (AAV). This antibody can be used to detect and quantify AAV in various samples, including human serum. Additionally, it has shown potential for use in the detection of alpha-fetoprotein and steroids.</p>

<p>Rabbit polyclonal TROVE2 antibody</p>

<p>Rabbit polyclonal FOXO4 antibody (Ser262)</p>

<p>The LDHA antibody is a monoclonal antibody that is used in the field of life sciences. It specifically targets lactate dehydrogenase A (LDHA), an enzyme involved in the conversion of pyruvate to lactate during anaerobic glycolysis. By inhibiting LDHA, this antibody can help researchers study the role of lactate metabolism in various biological processes. Whether you're conducting research or developing new therapeutic strategies, the LDHA antibody is a valuable tool for understanding and manipulating lactate levels in cells and tissues. Trust in its specificity and reliability to advance your scientific endeavors.</p>

<p>Rabbit polyclonal IL4 antibody (biotin)</p>

<p>PTGER2 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. Metabolized through various metabolic transformations, such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, this drug specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Phencyclidine cyclohexyl 4 Conjugate for use in immunoassays</p>

<p>The SIX6 antibody is a growth factor that belongs to the class of polyclonal antibodies. It specifically targets and binds to the SIX6 protein, which plays a crucial role in eye development. The antibody has been extensively studied for its ability to detect and measure the levels of SIX6 in various biological samples.</p>

<p>The HSP60 antibody is a monoclonal antibody that is used in Life Sciences research. It specifically targets the heat shock protein 60 (HSP60), which plays a crucial role in cellular stress response and protein folding. This antibody is widely used in various applications, including immunoblotting, immunohistochemistry, and flow cytometry.</p>

<p>Purified recombinant DAP protein (His tag)</p>

<p>IL1RA antibody was raised in rabbit using highly pure recombinant human IL-1RA as the immunogen.</p>

<p>Purified synthetic Bilirubin Conjugate protein</p>

<p>The Clenbuterol antibody is a monoclonal antibody that has neutralizing properties. It specifically targets and binds to Clenbuterol, a synthetic drug commonly used as a bronchodilator and for its anabolic effects. This antibody effectively blocks the activity of Clenbuterol, preventing it from binding to its target receptors.</p>

<p>Purified Rabbit polyclonal CAPN11 antibody</p>

<p>Purified Rabbit polyclonal EIF5B antibody</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

<p>PDS5B antibody was raised using a synthetic peptide corresponding to a region with amino acids DEQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMK</p>

<p>Glycoprotein 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SLQAALQPIVSSLNVSVDGNGEFIVRMALFQDQNYTNPYEGDAVELSVES</p>