Compuestos y reactivos bioquímicos

<p>Mouse anti- Furacilinum metabolite monoclonal antibody</p>

<p>Rabbit polyclonal SCO1 antibody</p>

<p>The anti-human CCR1 is a potent cytotoxic agent that targets the CCR1 receptor, a key molecule involved in various cellular processes. This monoclonal antibody specifically binds to the CCR1 receptor and inhibits its activation, leading to reduced collagen production and endothelial cell growth. The anti-human CCR1 antibody has been extensively studied in Life Sciences research and has shown significant efficacy in suppressing cell cytotoxicity. It is also effective against multidrug-resistant cells that overexpress the CCR1 receptor. Furthermore, this antibody can be used in combination with other therapeutic agents such as ethionamide to enhance their efficacy. The anti-human CCR1 antibody exhibits high specificity and affinity towards its target molecule, making it a valuable tool for researchers studying immune responses and inflammatory diseases. Additionally, this antibody has been used in hybridization studies to detect the presence of CCR1 mRNA and protein expression levels. Its ability to inhibit superoxide production further highlights its potential as an important tool in understanding</p>

<p>Cystatin B antibody was raised using a synthetic peptide corresponding to a region with amino acids AGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF</p>

<p>Rabbit polyclonal RAB11FIP2 antibody</p>

<p>Mouse monoclonal ACY3 antibody</p>

<p>Mouse monoclonal PSMC3 antibody</p>

<p>Chlamydia antibody was raised in mouse using Chlamydia antigen as the immunogen.</p>

<p>gAcrp30 antibody was raised in goat using highly pure recombinant human gAcrp30/adipolean as the immunogen.</p>

<p>Mouse monoclonal TNF beta antibody (allophycocyanin)</p>

<p>Purified Rabbit polyclonal ERF antibody</p>

<p>Mouse monoclonal GKAP antibody</p>

<p>The CREB antibody is a highly specialized monoclonal antibody that is designed to target and bind to the CREB protein. It is commonly used in research laboratories and medical settings for its ability to detect and measure levels of CREB in various biological samples. The antibody is produced using advanced techniques, including hybridization of human hepatocytes with chimeric proteins and subsequent purification steps. It is conjugated with bovine γ-globulin for enhanced stability and reliability.</p>

<p>The hnRNP A1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets hnRNP A1, a protein involved in various cellular processes including RNA metabolism and splicing. This antibody is commonly used in assays to study the function and localization of hnRNP A1 in different cell types and tissues. Additionally, it has been shown to have potential therapeutic applications in antiestrogen therapy, as it can inhibit the growth factor signaling pathway mediated by hnRNP A1. The hnRNP A1 antibody is highly specific and has been extensively validated for its performance in various experimental settings. With its ability to detect and quantify hnRNP A1 levels, this antibody is an essential tool for researchers studying adipose biology, fatty acid metabolism, and protein kinase signaling pathways.</p>

<p>Rabbit polyclonal SAR1A antibody</p>

<p>MIER1 antibody was raised in Rabbit using Human MIER1 as the immunogen</p>

<p>The ARAF antibody is a peptide receptor that is widely used in Life Sciences. It is available as both monoclonal and polyclonal antibodies, making it a versatile tool for researchers. This antibody specifically targets the ARAF protein, which plays a crucial role in various cellular processes. The ARAF antibody can be used as a diagnostic reagent to detect the expression of ARAF in different cell types or tissues. Additionally, it has been shown to be effective in studying tumor-related macrophages and their interactions with hematopoietic cells. The ARAF antibody is also useful for studying the extracellular environment and its impact on cellular behavior. Whether you are conducting research in cancer biology, immunology, or other fields, the ARAF antibody is an essential tool for investigating cellular signaling pathways and understanding disease mechanisms.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NEDD4L antibody, catalog no. 70R-2633</p>

<p>The BAG2 antibody is a highly specialized monoclonal antibody that targets specific antigens in the field of Life Sciences. This antibody specifically recognizes lysine residues on its target antigen, allowing for precise and accurate detection. The BAG2 antibody has been extensively studied for its ability to inhibit syncytia formation, a process involved in cell fusion. Additionally, this antibody has shown promising results as an inhibitor of growth factors and non-phosphorylated proteins. With its unique properties, the BAG2 antibody is a valuable tool for researchers studying various cellular processes, including the nuclear localization of β-catenin.</p>

<p>Serotonin receptor 3C antibody was raised using a synthetic peptide corresponding to a region with amino acids CCPTAPQKGNKGLGLTLTHLPGPKEPGELAGKKLGPRETEPDGGSGWTKT</p>

<p>Rat monoclonal CD122 antibody (biotin)</p>

<p>SETBP1 antibody was raised in rabbit using the middle region of SETBP1 as the immunogen</p>

<p>CXCR2 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The Rotavirus SA11 protein is a native protein that plays a crucial role in the antigen-antibody reaction. It has been widely used in research and diagnostic applications for its natriuretic properties. The Rotavirus SA11 protein can be utilized in various assays such as hybridization, phosphatase labeling, and neutralizing antibody assays. Additionally, it has shown potential therapeutic benefits in the treatment of conditions related to dopamine dysregulation and autoantibodies. This protein is also being explored for its ability to inhibit the growth factor and anti-beta amyloid activities. With its versatility and diverse applications, the Rotavirus SA11 protein is an essential component for researchers and scientists working in the field of Proteins and Antigens.</p>

<p>Rabbit polyclonal SF3A1 antibody</p>

<p>BSA conjugated Sulfamethoxazole Hapten</p>

<p>HADH antibody was raised using the C terminal of HADH corresponding to a region with amino acids YPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFG</p>

<p>Mouse monoclonal PKLR antibody</p>

<p>BTNL9 antibody was raised using the N terminal of BTNL9 corresponding to a region with amino acids EIRWFRSQTFNVVHLYQEQQELPGRQMPAFRNRTKLVKDDIAYGSVVLQL</p>

<p>The p38 MAPK antibody is a highly effective tool used in Life Sciences research. It is a polyclonal antibody that specifically targets and neutralizes the activity of p38 MAPK, a protein involved in various cellular processes. This antibody has been extensively tested and validated for its specificity and reliability.</p>

<p>The Perforin antibody is a monoclonal antibody that acts as an immunosuppressant in the field of Life Sciences. It specifically targets and neutralizes perforin, a protein involved in immune cell function. This antibody has been extensively studied and proven effective in inhibiting the activity of perforin, which plays a crucial role in cell-mediated cytotoxicity. By blocking perforin, this antibody helps regulate immune responses and has potential applications in various research areas such as cancer, autoimmune diseases, and transplantation. With its high specificity and potency, the Perforin antibody is a valuable tool for scientists studying immune system regulation and related pathways.</p>

<p>Rabbit polyclonal RPL30 antibody</p>

<p>JAKMIP2 antibody was raised in Rabbit using Human JAKMIP2 as the immunogen</p>

<p>SLC26A4 antibody was raised using the middle region of SLC26A4 corresponding to a region with amino acids ELNDRFRHKIPVPIPIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFL</p>

<p>The PLK1 antibody is a cyclic peptide that is widely used in Life Sciences research. It has a low pH and is able to penetrate cell membranes, making it an effective tool for studying protein kinase activity. This antibody has a stimulatory effect on cellular processes and can be used to investigate the role of specific proteins in various biological pathways.</p>

<p>Recombinant Human ACP2 protein (His tag)</p>

<p>Abcb10 antibody was raised in rabbit using the middle region of Abcb10 as the immunogen</p>

<p>MRPS12 antibody was raised using the N terminal of MRPS12 corresponding to a region with amino acids LVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRK</p>

<p>Mouse Tie2 immunogen; rat monoclonal Tie2 antibody (PE)</p>

<p>Rabbit polyclonal RABGGTA antibody</p>

<p>Rabbit polyclonal PLD3 antibody</p>

<p>Sheep polyclonal 4 Nitrophenyl AHD antibody</p>

<p>EDAR antibody is a cytotoxic monoclonal antibody that targets the EDAR protein. It contains disulfide bonds and has been shown to inhibit the binding of c-myc to its target DNA sequence. This antibody can be used for hybridization studies, as well as in vitro and in vivo experiments to investigate the role of EDAR in various biological processes. The EDAR antibody has been used as an inhibitor in studies investigating the function of EDAR signaling pathways. It has also been used in combination with other antibodies or drugs, such as ketamine, to enhance its cytotoxic effects. This monoclonal antibody specifically binds to the extracellular domain of EDAR and has been used as a tool in life sciences research to study the function and regulation of this protein.</p>

<p>Rat macrophage antibody was raised in rabbit using rat macrophages as the immunogen.</p>

<p>Diphtheria toxin antibody was raised in mouse using the A subunit (free &amp; bound) of diphtheria toxin as the immunogen.</p>

<p>RRAGD antibody was raised using the middle region of RRAGD corresponding to a region with amino acids CDMIDVVIDISCIYGLKEDGAGTPYDKESTAIIKLNNTTVLYLKEVTKFL</p>

<p>GPR27 antibody was raised using the N terminal of GPR27 corresponding to a region with amino acids MANASEPGGSGGGEAAALGLKLATLSLLLCVSLAGNVLFALLIVRERSLH</p>

<p>The PFKP antibody is a monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to the PFKP protein, which plays a crucial role in regulating glucose metabolism. This antibody is produced through advanced techniques that ensure high specificity and purity.</p>

<p>The PML antibody is a monoclonal antibody that specifically targets the protein known as promyelocytic leukemia (PML). It has been extensively studied in the field of Life Sciences and is widely used in research and diagnostic applications. The PML antibody binds to PML, inhibiting its activity and preventing its interaction with other proteins. This antibody has been shown to have neutralizing effects on PML function, making it a valuable tool for studying the role of PML in various cellular processes. Additionally, the PML antibody has been conjugated with different tags such as fluorescein isothiocyanate (FITC) or horseradish peroxidase (HRP), allowing for easy detection and visualization of PML in cells and tissues. With its high specificity and affinity, the PML antibody provides researchers with a reliable tool for investigating the function of PML and its potential involvement in disease processes.</p>

<p>Purified recombinant BSND protein (His tag)</p>