Compuestos y reactivos bioquímicos

<p>EIF2C3 antibody was raised using the N terminal of EIF2C3 corresponding to a region with amino acids MCEVLDIHNIDEQPRPLTDSHRVKFTKEIKGLKVEVTHCGTMRRKYRVCN</p>

<p>POLR2B antibody was raised in rabbit using the N terminal of POLR2B as the immunogen</p>

<p>Recombinant Human ACPP protein (His tag)</p>

<p>The PECAM1 antibody is a highly specialized antibody that targets the Platelet Endothelial Cell Adhesion Molecule-1 (PECAM1). It is commonly used in research and life sciences applications involving mesenchymal stem cells. This antibody comes in both polyclonal and monoclonal forms, offering researchers a wide range of options for their experiments.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CYP4B1 antibody, catalog no. 70R-7503</p>

<p>1-314 amino acids: MGSSHHHHHH SSGLVPRGSH MSRVPAFLSA AEVEEHLRSS SLLIPPLETA LANFSSGPEG GVMQPVRTVV PVTKHRGYLG VMPAYSAAED ALTTKLVTFY EDRGITSVVP SHQATVLLFE PSNGTLLAVM DGNVITAKRT AAVSAIATKF LKPPSSEVLC ILGAGVQAYS HYEIFTEQFS FKEVRIWNRT KENAEKFADT VQGEVRVCSS VQEAVAGADV IITVTLATEP ILFGEWVKPG AHINAVGASR PDWRELDDEL MKEAVLYVDS QEAALKESGD VLLSGAEIFA ELGEVIKGVK PAHCEKTTVF KSLGMAVEDT VAAKLIYDSW SSGK</p>

<p>Collagen Type VI Alpha 1 antibody was raised using the middle region of COL6A1 corresponding to a region with amino acids ADITILLDGSASVGSHNFDTTKRFAKRLAERFLTAGRTDPAHDVRVAVVQ</p>

<p>DLL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPC</p>

<p>112-270 amino acids: MSITGISPIT EYLASLSTYN DQSITFALED ESYEIYVEDL KKDEKKDKVL LSYYESQHPS NESGDGVDGK MLMVTLSPTK DFWLHANNKE HSVELHKCEK PLPDQAFFVL HNMHSNCVSF ECKTDPGVFI GVKDNHLALI KVDSSENLCT ENILFKLSET</p>

<p>Mouse monoclonal JEV PreM antibody</p>

<p>GABRG1 antibody was raised in Rabbit using Human GABRG1 as the immunogen</p>

<p>Mouse monoclonal CTAG1B antibody</p>

<p>Mouse monoclonal GSTT2 antibody</p>

<p>Leiomodin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRVAKYRRQVSEDPDIDSLLETLSPEEMEELEKELDVVDPDGSVPVGLRQ</p>

<p>The GPR171 antibody is a highly specialized polyclonal antibody that is designed to target and bind to the GPR171 receptor. This receptor is activated by progesterone, interferon, and growth hormone, making it an important target for research in the field of Life Sciences. The GPR171 antibody can be used in various applications such as immunoassays and neutralizing experiments. It is also compatible with aldehyde-based fixation methods, allowing for easy integration into existing research protocols. With its high specificity and affinity, this monoclonal antibody is an invaluable tool for scientists studying chemokine signaling pathways and steroid receptors.</p>

<p>CYTL1 antibody was raised in Rabbit using Human CYTL1 as the immunogen</p>

<p>TRIM67 antibody was raised using the C terminal of TRIM67 corresponding to a region with amino acids GGVCKGATVGVLLDLNKHTLTFFINGQQQGPTAFSHVDGVFMPALSLNRN</p>

<p>GALNT10 antibody was raised using the N terminal Of Galnt10 corresponding to a region with amino acids VPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVAVQKKLRSS</p>

<p>MER antibody was raised in Mouse using a purified recombinant fragment of MER expressed in E. coli as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAGEL2 antibody, catalog no. 70R-9924</p>

<p>ARL6IP1 antibody was raised in rabbit using the C terminal of ARL6IP1 as the immunogen</p>

<p>AChE antibody was raised using a synthetic peptide corresponding to a region with amino acids SMNYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSV</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AKT2 antibody, catalog no. 70R-7833</p>

<p>The DOCK11 antibody is a growth factor that plays a crucial role in various processes within the Life Sciences field. It is an essential component in cell antigen recognition and the production of antibodies. The DOCK11 antibody has been shown to inhibit the activity of protons, which are responsible for acidification and cellular damage. Additionally, it has been found to have inhibitory effects on interleukin-6, a cytokine involved in inflammation and immune response regulation.</p>

<p>Purified Polyclonal SEC61B antibody</p>

<p>XPOT antibody was raised using a synthetic peptide corresponding to a region with amino acids TVLSDQQKANVEAIMLAVMKKLTYDEEYNFENEGEDEAMFVEYRKQLKLL</p>

<p>Rabbit polyclonal WDR46 antibody</p>

<p>Recombinant Human RNMTL1 protein (His tag)</p>

<p>Rabbit anti-goat IgG (HRP) was raised in rabbit using goat IgG F(ab')2 fragment as the immunogen.</p>

<p>Purified recombinant Human ENOPH1 protein</p>

<p>LENG4 antibody was raised using the C terminal Of Leng4 corresponding to a region with amino acids LSAYWHGLHPGYYLSFLTIPLCLAAEGRLESALRGRLSPGGQKAWDWVHW</p>

<p>The Estrogen Receptor alpha antibody is a highly specialized biomolecule used in the field of life sciences. It is a monoclonal antibody that specifically targets the estrogen receptor alpha, a nuclear receptor involved in various cellular processes. This antibody recognizes and binds to the antigen binding domain of the estrogen receptor alpha, allowing for precise detection and analysis.</p>

<p>The ID2 antibody is a monoclonal antibody that has a high affinity for various proteins, including serum albumin, alpha-fetoprotein, collagen, fibronectin, and erythropoietin. This antibody is widely used in the field of Life Sciences for research purposes. It can be utilized to study protein-protein interactions, as well as to detect the presence of specific proteins in samples. The ID2 antibody has been shown to inhibit the growth of endothelial cells by blocking the activity of certain growth factors. It also plays a role in regulating the glycosylation process and interferon signaling pathways. This antibody is particularly useful in studies related to human serum, androgen metabolism, low-density lipoprotein metabolism, and cancer research. With its versatility and specificity, the ID2 antibody is an invaluable tool for researchers in various fields.</p>

<p>Rabbit polyclonal Tenascin antibody (biotin)</p>

<p>HERC5 antibody was raised using the N terminal of HERC5 corresponding to a region with amino acids CLVAELVGYRVTQIACGRWHTLAYVSDLGKVFSFGSGKDGQLGNGGTRDQ</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ADH1A antibody, catalog no. 70R-3919</p>

<p>Rabbit Polyclonal Cofilin antibody (Ser3)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CSTB antibody, catalog no. 70R-2262</p>

<p>GST antibody was raised in mouse using recombinant Glutathione S transferase (GST) purified from E. coli as the immunogen.</p>

<p>The hCG beta antibody is a protein that belongs to the Life Sciences category. It functions by binding to the nuclear factor kappa-light-chain-enhancer in order to regulate gene expression. This antibody is commonly used in research and diagnostic applications, particularly in the field of reproductive health. It has been shown to interact with various proteins, including mitogen-activated protein and β-catenin, which are involved in cellular signaling pathways. Additionally, this antibody has been found to have an inhibitory effect on the activity of p38 mitogen-activated protein phosphatase and caspase-9, both of which play important roles in cell growth and apoptosis. The hCG beta antibody is available as a monoclonal antibody, making it highly specific and reliable for use in experiments and assays requiring precise detection and analysis of target molecules.</p>

<p>Purified recombinant CD1B protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRPC4 antibody, catalog no. 70R-5142</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. Specifically designed to treat tuberculosis infections, this compound exhibits strong bactericidal activity. It works by binding to DNA-dependent RNA polymerase, effectively inhibiting bacterial growth and preventing transcription and replication. In addition, it has been shown to have high human activity using a patch-clamp technique on human erythrocytes. Metabolized through various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, this drug specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>SPINT2 antibody was raised using the middle region of SPINT2 corresponding to a region with amino acids MLRCFRQQENPPLPLGSKVVVLAGLFVMVLILFLGASMVYLIRVARRNQE</p>

<p>RSAD2 antibody was raised using the C terminal of RSAD2 corresponding to a region with amino acids YLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKY</p>

<p>Purified recombinant MIF protein (His tag)</p>

<p>TSGA13 antibody was raised using the middle region of TSGA13 corresponding to a region with amino acids ASERPISKVIREPLTLASLLEDMPTRTAPGESAFRNGRAPQWIIKKATVI</p>

<p>NHP2 antibody was raised in Rabbit using Human NHP2 as the immunogen</p>

<p>The MIF antibody is a highly effective inhibitor that targets the polymers of macrophage migration inhibitory factor (MIF). This monoclonal antibody has neutralizing properties and is specifically designed to block the activity of MIF. It has been extensively used in Life Sciences research, particularly in studies related to annexin A2 and chemokine regulation. The MIF antibody can be used in various experimental techniques, including Western blotting, immunohistochemistry, and flow cytometry. Its high affinity for MIF makes it a valuable tool for researchers studying cardiomyocyte function and investigating the role of MIF in different biological processes. When combined with streptavidin or other detection systems, this monoclonal antibody provides reliable and accurate results. Choose the MIF antibody for your research needs and unlock new insights into the intricate mechanisms of cellular signaling pathways.</p>

<p>ACTH antibody was raised in mouse using ACTH-BSA as the immunogen.</p>