Compuestos y reactivos bioquímicos

<p>Purified recombinant DEFB116 protein (His tag)</p>

<p>Rat monoclonal V alpha 2 TCR antibody (PE)</p>

<p>Aquaporin 7 antibody was raised using the C terminal of AQP7 corresponding to a region with amino acids DSVAYEDHGITVLPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMA</p>

<p>The TIE1 antibody is a highly specific antibody that targets the TIE1 protein, which is an important receptor involved in various biological processes. This monoclonal antibody is widely used in life sciences research to study the role of TIE1 in insulin signaling, adiponectin signaling, and growth factor regulation.</p>

<p>CYP3A43 antibody was raised using the C terminal of CYP3A43 corresponding to a region with amino acids IYALHHDPKYWTEPEKFCPESRFSKKNKDSIDLYRYIPFGAGPRNCIGMR</p>

<p>Mouse monoclonal CP15 antibody</p>

<p>Rabbit polyclonal OR10C1 antibody</p>

<p>Mouse monoclonal MAP2K4 antibody</p>

<p>The SERPINE1 antibody is a highly specialized antibody that targets the glutamate receptor. It belongs to the class of polyclonal antibodies and has been extensively studied in the field of Life Sciences. This antibody specifically interacts with β-catenin, a protein involved in cell adhesion and signaling pathways. It also inhibits the activity of colony-stimulating factors, which are important for immune response regulation. The SERPINE1 antibody has been shown to be reactive against various monoclonal antibodies, making it a versatile tool for research purposes. Additionally, it exhibits cytotoxic effects on pluripotent cells and can inhibit the activity of protein kinases, including oncogenic kinases. This monoclonal antibody is non-phosphorylated, ensuring its stability and effectiveness in experimental settings. With its wide range of applications in molecular biology and immunology research, the SERPINE1 antibody is an invaluable tool for scientists seeking to unravel complex cellular mechanisms.</p>

<p>Rabbit polyclonal RIMS3 antibody</p>

<p>ALDOC antibody was raised using the C terminal of ALDOC corresponding to a region with amino acids CPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAA</p>

<p>Mouse monoclonal PLEK antibody</p>

<p>Rabbit polyclonal PPAR gamma antibody (Ser112)</p>

<p>Rabbit polyclonal SPHK1 antibody</p>

<p>Purified recombinant JAM3 protein (His tag)</p>

<p>Rabbit polyclonal COL4A1 antibody (HRP)</p>

<p>Mouse monoclonal Myosin antibody</p>

<p>Mouse monoclonal EFNA2 antibody</p>

<p>The Keratin 18 antibody is a nanocomposite that consists of a DNA aptamer with an amino group. It can be used in Life Sciences research to study the growth factor and protein kinases involved in various cellular processes. The antibody specifically targets Keratin 18, which is a protein expressed in epithelial cells. This monoclonal antibody allows for the detection and visualization of Keratin 18 through an antigen-antibody reaction. It can be used in applications such as immunofluorescence staining, western blotting, and polymerase chain reactions (PCR). The Keratin 18 antibody is highly specific and sensitive, making it a valuable tool for researchers studying cellular biology and disease mechanisms.</p>

<p>Rabbit polyclonal GPR92 antibody</p>

<p>Purified Polyclonal MYST4 antibody</p>

<p>FSH antibody was raised in mouse using high purity intact FSH from human pituitary gland as the immunogen.</p>

<p>Haptoglobin antibody was raised against Human Haptoglobin.</p>

<p>PIGQ antibody was raised using the N terminal of PIGQ corresponding to a region with amino acids PTVLPDRQAGATTASTGGLAAVFDTVARSEVLFRSDRFDEGPVRLSHWQS</p>

<p>Mouse monoclonal NT5DC1 antibody</p>

<p>Purified recombinant HOXC11 protein (His tag)</p>

<p>Rabbit polyclonal Caspase 1 antibody (FITC)</p>

<p>Mouse monoclonal OMP28 antibody</p>

<p>Sheep polyclonal Sulphanitran antibody</p>

<p>RPL37A antibody was raised using the middle region of RPL37A corresponding to a region with amino acids CGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELKD</p>

<p>Mouse monoclonal DPP9 antibody</p>

<p>Rabbit polyclonal CK2A1 antibody (Tyr255)</p>

<p>MGSSHHHHHH SSGLVPRGSH MAEDADMRNE LEEMQRRADQ LADESLESTR RMLQLVEESK DAGIRTLVML DEQGEQLERI EEGMDQINKD MKEAEKNLTD LGKFCGLCVC PCNKLKSSDA YKKAWGNNQD GVVASQPARV VDEREQMAIS GGFIRRVTND ARENEMDENL EQVSGIIGNL RHMALDMGNE IDTQNRQIDR IMEKADSNKT RIDEANQRAT KMLGSG</p>

<p>The TFR2 antibody is a highly effective tool in antiestrogen therapy. It specifically targets the histamine H4 receptor, which plays a crucial role in estrogen signaling pathways. By blocking this receptor, the TFR2 antibody effectively inhibits the growth and proliferation of estrogen-dependent tumors.</p>

<p>Purified Rabbit polyclonal ACVR1B antibody</p>

<p>Purified recombinant SIAH1 protein (His tag)</p>

<p>Avilamycin Conjugate for use in immunoassays</p>

<p>Purified Rabbit polyclonal EIF2AK1 antibody</p>

<p>UBE2M antibody was raised using a synthetic peptide corresponding to a region with amino acids IKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISF</p>

<p>NDUFA9 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPY</p>

<p>The nNOS antibody is a highly effective tool in the field of atypical hemolytic research. It is specifically designed to target and detect brucella abortus, a bacterium that causes serious infections in animals and humans. This antibody belongs to the class of polyclonal antibodies, which means it can recognize multiple epitopes on the target protein.</p>

<p>Toxoplasma gondii protein is a versatile and essential component in the field of Life Sciences. This protein exhibits various characteristics that make it highly valuable for research purposes. It possesses epidermal growth factor properties, making it an excellent candidate for studying cellular growth and development. Additionally, Toxoplasma gondii protein has been found to have neutralizing effects, which can be utilized in the development of therapeutic interventions.</p>

<p>Sheep polyclonal Flunixin antibody</p>

<p>Purified recombinant PRRT2 protein (His tag)</p>

<p>Tead4 antibody was raised in rabbit using the middle region of Tead4 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MYOZ1 antibody, catalog no. 70R-2197</p>

<p>Rabbit polyclonal KLHDC2 antibody</p>

<p>Rat monoclonal CIRE antibody (biotin)</p>

<p>Cathepsin B protein is a versatile enzyme that plays a crucial role in various biological processes. It is commonly used in research and diagnostic applications. Cathepsin B protein can be easily activated using an electrode or other suitable methods. It is often used in studies involving human serum, where it helps to understand the mechanisms of certain diseases. Monoclonal antibodies specific to Cathepsin B protein are available, which enable researchers to study its functions and interactions with other proteins. Recombinant proteins of Cathepsin B are also widely used in various experiments and assays.</p>

<p>Purified recombinant LRRC59 protein (His tag)</p>