Compuestos y reactivos bioquímicos

<p>The VEGFD antibody is a highly specialized antibody that targets Vascular Endothelial Growth Factor D (VEGFD). This antibody has been extensively studied and has shown great potential in various fields, particularly in the Life Sciences.</p>

<p>Recombinant E.coli idnk protein</p>

<p>Purified recombinant CNRIP1 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of VSIG8 antibody, catalog no. 70R-6416</p>

<p>MPP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSLRTQSLKTLRNSDLKPYIIFIAPPSQERLRALLAKEGKNPKPEELREI</p>

<p>MIP1 beta antibody was raised in rabbit using highly pure recombinant human MIP-1-beta as the immunogen.</p>

<p>Affinity purified Rabbit polyclonal HRPAP20 antibody</p>

<p>Purified Polyclonal IKK gamma antibody</p>

<p>Sheep polyclonal Clostebol antibody</p>

<p>Rabbit polyclonal IKK gamma antibody (Ser376)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FTCD antibody, catalog no. 70R-1140</p>

<p>Purified Polyclonal NEFL antibody</p>

<p>The CD18 antibody is a highly specialized Polyclonal Antibody used in Life Sciences research. It is known for its antiangiogenic properties and its ability to neutralize endothelial growth factors, chemokines, and other growth factors involved in cell proliferation. This antibody has been extensively studied and proven effective in various research applications.</p>

<p>Purified recombinant Human AHCY protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PPIE antibody, catalog no. 70R-1435</p>

<p>Purified native Pneumonia virus of Mice protein</p>

<p>Rabbit polyclonal GLI3 antibody</p>

<p>CMV pp65 protein:<br>CMV pp65 (120-129) is an epitope of the main component of the enveloped subviral particle pp65 (phosphoprotein ppUL83) of Cytomegalovirus, a member of herpes virus group. CMV pp65 antigens are used as target for the diagnosis of concomitant CMV end-organ disease.<br>Applications of CMV pp65 (120-129):<br>CMV pp65 (120-129) HLA-A*02:01-restricted is an immunodominant target of CD4+ and CD8+ responses to CMV. CMV pp65 (120-129) is used to stimulate in vitro pp65-specific CD4+ and CD8+ T cells in PBMCs and to analyze by ELISPOT peptide epitope specificity and cytokine production like IFN-γ, IL-2 and TFN-α.</p>

<p>BACE1 antibody was raised using the N terminal of BACE1 corresponding to a region with amino acids GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY</p>

<p>The BARD1 antibody is a highly specific monoclonal antibody that targets the BARD1 protein isoforms. It has been extensively tested and validated in various bioassays and is widely used in life sciences research. This antibody specifically recognizes BARD1, a protein involved in cell growth regulation and DNA repair processes. It binds to BARD1 with high affinity, making it an excellent tool for studying the function and localization of this important protein. The BARD1 antibody can be used in applications such as Western blotting, immunohistochemistry, and immunofluorescence to investigate the role of BARD1 in different cellular contexts. Its high specificity ensures accurate and reliable results, making it an indispensable tool for researchers studying cell signaling pathways and cancer biology.</p>

<p>Purified recombinant GPI protein (His tag)</p>

<p>Rat monoclonal PD1 antibody (PE)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ADSSL1 antibody, catalog no. 70R-4108</p>

<p>Rabbit polyclonal KOR1 antibody</p>

<p>Mouse monoclonal MGLL antibody</p>

<p>Mouse monoclonal SLC2A6 antibody</p>

<p>RTN3 antibody was raised in Mouse using a purified recombinant fragment of RTN3 expressed in E. coli as the immunogen.</p>

<p>Goat anti-rat IgG (H + L) (Fab'2) (Rhodamine) was raised in goat using rat IgG whole molecule as the immunogen.</p>

<p>Purified recombinant DTYMK protein</p>

<p>Purified recombinant Treponema pallidum protein</p>

<p>Purified Polyclonal 14 3 3 theta antibody</p>

<p>The N cadherin antibody is a powerful tool in the field of Life Sciences. It plays a crucial role in various biological processes such as cell adhesion, differentiation, and migration. This antibody specifically targets N cadherin, a protein that is involved in cell-cell adhesion and signaling.</p>

<p>Purified Polyclonal ACOT8 antibody</p>

<p>POFUT2 antibody was raised using the C terminal of POFUT2 corresponding to a region with amino acids RFEPTWEELELYKDGGVAIIDQWICAHARCLPTSLSAESGSGGFQRFFCP</p>

<p>LARP6 antibody was raised using the middle region of LARP6 corresponding to a region with amino acids MGTQEKSPGTSPLLSRKMQTADGLPVGVLRLPRGPDNTRGFHGHERSRAC</p>

<p>Purified recombinant GNAZ protein (His tag)</p>

<p>Rabbit polyclonal PPP1R14A antibody</p>

<p>The Tyrosine Hydroxylase antibody is a specific antibody used in Life Sciences research. It is commonly used to study the cholinergic and dopamine systems in the brain. This antibody targets tyrosine hydroxylase, which is an enzyme involved in the synthesis of dopamine. By detecting and measuring levels of tyrosine hydroxylase, researchers can gain valuable insights into neurological disorders such as Parkinson's disease and schizophrenia.</p>

<p>PDHA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDRMVNSNLASVEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIYS</p>

<p>Purified recombinant RPL11 protein (His tag)</p>

<p>9-OH Risperidone chemical reference substance</p>

<p>Mouse monoclonal IkBa antibody (N-terminus)</p>

<p>Mouse monoclonal CYB5R1 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycins class. It is specifically designed to target tuberculosis infection and contains active compounds that exhibit strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Extensive research has been conducted using a patch-clamp technique on human erythrocytes, confirming its high efficacy in humans. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it selectively binds to markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits cell growth in culture.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Eif4e antibody, catalog no. 70R-9620</p>

<p>CCND3 antibody was raised in Rabbit using Human CCND3 as the immunogen</p>

<p>Purified recombinant LYG2 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PRRC1 antibody, catalog no. 70R-3262</p>

<p>GRIN1 antibody was raised in Rabbit using Human GRIN1 as the immunogen</p>

<p>The NUMB antibody is a monoclonal antibody derived from streptomyces. It has hypomethylating properties and is used in the field of life sciences for various applications. This antibody specifically targets and binds to NUMB, a protein involved in cell differentiation and development. The NUMB antibody has chemotherapeutic potential and has been studied for its ability to inhibit the growth of cancer cells. It can also be used in research settings for chromatographic and immunohistochemical studies. With its unique properties and specificity, the NUMB antibody offers promising avenues for further exploration in the field of molecular biology and therapeutics.</p>