Compuestos y reactivos bioquímicos
Los bioquímicos y reactivos son sustancias fundamentales para la investigación y el desarrollo en campos como la biotecnología, la biología molecular, la farmacología y la medicina. Estos productos son esenciales para una variedad de aplicaciones, incluyendo la síntesis de compuestos, el análisis de muestras biológicas, la investigación de procesos metabólicos y la producción de medicamentos. En CymitQuimica, ofrecemos una amplia selección de bioquímicos y reactivos de alta calidad y pureza, adecuados para diversas necesidades científicas e industriales. Nuestro catálogo incluye enzimas, anticuerpos, ácidos nucleicos, aminoácidos, y muchos otros productos, todos diseñados para apoyar a los investigadores y profesionales en sus proyectos de investigación y desarrollo, asegurando resultados confiables y reproducibles.
Subcategorías de "Compuestos y reactivos bioquímicos"
- Biomoléculas(99.104 productos)
- Por objetivo biológico(99.074 productos)
- Según efectos farmacológicos(6.784 productos)
- Crioconservantes(21 productos)
- Desinfectantes y compuestos relacionados(28 productos)
- Hormonas(346 productos)
- Biología Vegetal(6.693 productos)
- Metabolitos secundarios(14.218 productos)
Se han encontrado 130576 productos de "Compuestos y reactivos bioquímicos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
5HIAA ELISA Kit
<p>5HIAA ELISA Kit for the quantitative determination of 5HIAA in urine</p>Pureza:Min. 95%PDGFB antibody
<p>PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD</p>Pureza:Min. 95%Human MMP1 ELISA Kit
<p>ELISA kit for detection of MMP1 in the research laboratory</p>Pureza:Min. 95%Human TGFB1 ELISA Kit
<p>ELISA Kit for detection of TGFB1 in the research laboratory</p>Pureza:Min. 95%H-MEVGWYRPPFSRVVHLYRNGK-OH
<p>MOG(35-55) human corresponds to amino acids 35 to 55 of the human myelin oligodendrocyte glycoprotein (MOG). It can be used in multiple sclerosis research to induce experimental autoimmune encephalomyelitis (EAE) in mouse and rat models.</p>Mouse Prealbumin ELISA Kit
<p>Please enquire for more information about Mouse Prealbumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%p-Perfluoroterphenyl
CAS:<p>p-Perfluoroterphenyl is a potent inhibitor of kinases, which are enzymes that play a crucial role in the regulation of cell growth and division. This compound has been extensively studied in Chinese medicinal research for its anticancer properties. It has been shown to inhibit the growth of tumor cells and induce apoptosis, or programmed cell death, in cancer cells. Additionally, p-Perfluoroterphenyl has been found to be an effective inhibitor of protein kinases, which regulate many important cellular processes. This analog has also been detected in human urine samples, indicating its potential as a diagnostic tool for cancer detection and treatment. Overall, p-Perfluoroterphenyl is a promising new compound with potential applications in cancer therapy and diagnosis.</p>Fórmula:C18F14Pureza:Min. 95%Peso molecular:482.2 g/molRef: 3D-DAA00831
Producto descatalogadoSR-4370
CAS:<p>SR-4370 is a potent inhibitor of the histone deacetylase (HDAC) enzyme class. It has been shown to inhibit cholesterol synthesis and lipid biosynthesis in cells, as well as inhibiting cancer cell proliferation. SR-4370 also has antioxidant effects, which may be due to its ability to inhibit the activation of NF-κB and downstream mediators. In addition, this compound has been shown to have synergistic effects with other HDAC inhibitors and chemotherapy drugs. This drug is being developed for the treatment of cancers such as prostate cancer, melanoma, breast cancer, colon cancer, and head and neck cancer.</p>Fórmula:C17H18F2N2OPureza:Min. 95%Peso molecular:304.33 g/molRef: 3D-RXC29467
Producto descatalogadoHamster (CHO) GTP-binding Nuclear Protein (RAN) ELISA Kit
<p>Please enquire for more information about Hamster (CHO) GTP-binding Nuclear Protein (RAN) ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Mouse Leptin ELISA Kit
<p>Leptin is a cell-signalling hormone vital in the regulation of appetite, food intake and body weight. Studies have shown that an absence of leptin in the body or leptin resistance can lead to uncontrolled feeding and weight gain. Because obesity is an established risk factor in various cancers and leptin plays a significant role in the physiopathology of obesity, the exploration of leptin's link to cancer risk is of considerable importance.</p>Pureza:Min. 95%PEDV Nucleocapsid Protein - Purified
<p>This Porcine epidemic diarrhea virus nucleocapsid protein is expressed in E.coli and contains a 6xHIS tag.</p>Pureza:Min. 95%Mouse MMP1 ELISA kit
<p>ELISA Kit for detection of MMP1 in the research laboratory</p>Pureza:Min. 95%ASCA IgA/IgG ELISA kit
<p>ELISA kit for the detection of ASCA IgA/IgG in the research laboratory</p>Pureza:Min. 95%Chlamydia pneumoniae IgG ELISA kit
<p>ELISA kit for the detection of Chlamydia pneumoniae IgG in the research laboratory</p>Pureza:Min. 95%Mouse Cystatin C ELISA Kit
<p>ELISA kit for detection of Cystatin C in the research laboratory</p>Pureza:Min. 95%Mouse Free Thyroxine ELISA kit
<p>ELISA Kit for detection of Free Thyroxine in the research laboratory</p>Pureza:Min. 95%Human PDGFAB ELISA Kit
<p>ELISA Kit for detection of PDGFAB in the research laboratory</p>Pureza:Min. 95%Human TNF α ELISA kit
<p>ELISA kit for the detection of TNF alpha in the research laboratory</p>Pureza:Min. 95%Mouse RANKL ELISA Kit
<p>ELISA kit for detection of Mouse RANKL in the research laboratory</p>Pureza:Min. 95%Rat PAI1 ELISA Kit
<p>ELISA kit for detection of Rat PAI1 in the research laboratory</p>Pureza:Min. 95%Peptide YY(3-36), PYY, human
<p>Custom research peptide; min purity 95%.</p>Fórmula:C180H279N53O54Pureza:Min. 95%Peso molecular:4,049.55 g/molRef: 3D-PP17072
Producto descatalogado2-[(1S,2S)-1-Ethyl-2-(phenylmethoxy)propyl]hydrazine
CAS:<p>2-[(1S,2S)-1-Ethyl-2-(phenylmethoxy)propyl]hydrazine is a human analog that has been found to have anticancer properties. It acts as an inhibitor of kinases, which are enzymes involved in the regulation of cell growth and division. This compound induces apoptosis in Chinese hamster ovary cells and inhibits tumor growth in mice. 2-[(1S,2S)-1-Ethyl-2-(phenylmethoxy)propyl]hydrazine has medicinal potential as a cancer therapy due to its ability to inhibit protein kinases that are involved in the development of cancer cells. This compound may be used as a therapeutic agent for various types of cancer, especially those that are resistant to conventional chemotherapy. It has also been detected in human urine, indicating its potential for use as a diagnostic tool for cancer.</p>Fórmula:C12H20N2OPureza:Min. 95%Peso molecular:208.3 g/molRef: 3D-IHA87134
Producto descatalogadoIgG1 κ Isotype Control Fc fusion protein (PE)
<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein (PE)</p>Pureza:Min. 95%Toxoplasma gondii IgG ELISA kit
<p>ELISA kit for the detection of Toxoplasma gondii IgG in the research laboratory</p>Pureza:Min. 95%Gliadin IgA ELISA kit
<p>ELISA kit for the detection of Gliadin IgA in the research laboratory</p>Pureza:Min. 95%Sperm Antibodies ELISA kit
<p>ELISA kit for the detection of Sperm Antibodies in the research laboratory</p>Pureza:Min. 95%Human MMP3 ELISA Kit
<p>ELISA Kit for detection of MMP3 in the research laboratory</p>Pureza:Min. 95%IgG1 κ Isotype Control Fc fusion protein (FITC)
<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein (FITC)</p>Pureza:Min. 95%Human Cystatin C ELISA kit
<p>ELISA kit for the detection of Cystatin C in the research laboratory</p>Pureza:Min. 95%Rabbit MMP1 ELISA kit
<p>ELISA Kit for detection of MMP1 in the research laboratory</p>Pureza:Min. 95%Rat Free Thyroxine ELISA kit
<p>ELISA Kit for detection of Free Thyroxine in the research laboratory</p>Pureza:Min. 95%PTH ELISA kit
<p>ELISA kit for the detection of PTH intact in the research laboratory</p>Pureza:Min. 95%Human CRP ELISA Kit
<p>C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.<br>High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.<br>;</p>Pureza:Min. 95%Human RBP4 ELISA Kit
<p>ELISA kit for detection of RBP4 in the research laboratory</p>Pureza:Min. 95%TSH antibody
<p>TSH antibody was raised in rabbit using human TSH as the immunogen.</p>Pureza:Min. 95%FSH antibody
<p>The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.</p>Pureza:Min. 95%Human leukotriene E4 ELISA kit
<p>ELISA Kit for detection of leukotriene E4 in the research laboratory</p>Pureza:Min. 95%Human PGF2a ELISA kit
<p>ELISA Kit for detection of PGF2a in the research laboratory</p>Pureza:Min. 95%Mouse Leptin Receptor ELISA kit
<p>ELISA kit for the detection of Leptin Receptor in the research laboratory</p>Pureza:Min. 95%CRP antibody
<p>CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.</p>
![2-[(1S,2S)-1-Ethyl-2-(phenylmethoxy)propyl]hydrazine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FIHA87134.webp&w=3840&q=75)
