Compuestos y reactivos bioquímicos
Los bioquímicos y reactivos son sustancias fundamentales para la investigación y el desarrollo en campos como la biotecnología, la biología molecular, la farmacología y la medicina. Estos productos son esenciales para una variedad de aplicaciones, incluyendo la síntesis de compuestos, el análisis de muestras biológicas, la investigación de procesos metabólicos y la producción de medicamentos. En CymitQuimica, ofrecemos una amplia selección de bioquímicos y reactivos de alta calidad y pureza, adecuados para diversas necesidades científicas e industriales. Nuestro catálogo incluye enzimas, anticuerpos, ácidos nucleicos, aminoácidos, y muchos otros productos, todos diseñados para apoyar a los investigadores y profesionales en sus proyectos de investigación y desarrollo, asegurando resultados confiables y reproducibles.
Subcategorías de "Compuestos y reactivos bioquímicos"
- Biomoléculas(99.185 productos)
- Por objetivo biológico(99.150 productos)
- Según efectos farmacológicos(6.789 productos)
- Crioconservantes(21 productos)
- Desinfectantes y compuestos relacionados(28 productos)
- Hormonas(346 productos)
- Biología Vegetal(6.764 productos)
- Metabolitos secundarios(14.307 productos)
Se han encontrado 130581 productos de "Compuestos y reactivos bioquímicos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
TPTE antibody
<p>TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL</p>Nucleosome ELISA kit
<p>ELISA kit for the detection of Nucleosome in the research laboratory</p>Pureza:Min. 95%Folic Acid protein
<p>Folic Acid protein is a versatile compound widely used in Life Sciences. It has various applications, including its role as an anti-HER2 antibody in human serum. Folic Acid protein interacts with insulin and epidermal growth factor, making it essential for cellular processes and growth regulation. Additionally, it has been found to have autoantibodies and acidic properties that contribute to its effectiveness as a growth factor. Folic Acid protein also exhibits anti-glial fibrillary acidic properties, which can be beneficial in certain medical conditions. With its unique amino group and carbonyl group composition, Folic Acid protein plays a crucial role in the development of insulins and other Recombinant Proteins & Antigens. Moreover, it has shown promising results when combined with trastuzumab, an anti-glial fibrillary antibody used in cancer treatment.</p>Pureza:Min. 95%Rat Leptin ELISA kit
<p>ELISA Kit for detection of Leptin in the research laboratory</p>Pureza:Min. 95%GSK J4
CAS:<p>Inhibitor of histone demethylase</p>Fórmula:C24H27N5O2Pureza:Min. 95%Peso molecular:417.5 g/molCNDP1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CNDP1 antibody, catalog no. 70R-10125</p>Pureza:Min. 95%Human IL12 ELISA Kit (p70)
<p>ELISA Kit for detection of IL12 (p70) in the research laboratory</p>Pureza:Min. 95%Coagulation Factor III ELISA kit
<p>ELISA Kit for detection of Mouse Coagulation Factor III in the research laboratory</p>Pureza:Min. 95%Rabbit IL17 ELISA kit
<p>ELISA Kit for detection of IL17 in the research laboratory</p>Pureza:Min. 95%Hamster CHO Clusterin ELISA Kit
<p>Hamster (CHO) Clusterin ELISA Kit<br>Clusterin plays key roles in protein homeostasis/proteostasis, and the modulation of pro-survival signaling networks.</p>Pureza:Min. 95%Bovine CRP ELISA Kit
<p>Bovine/Cow CRP ELISA Kit - For the quantitative determination of c-reactive protein (CRP) in cow/bovine samples.</p>Pureza:Min. 95%Rat IgE ELISA Kit
<p>Please enquire for more information about Rat IgE ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%dsDNA IgA ELISA kit
<p>ELISA kit for the detection of dsDNA IgA in the research laboratory</p>Pureza:Min. 95%Human Haptoglobin ELISA Kit
<p>Please enquire for more information about Human Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Mouse IgG2A ELISA Kit
<p>Please enquire for more information about Mouse IgG2A ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Rat IgG ELISA Kit
<p>Please enquire for more information about Rat IgG ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Adrenaline/Noradrenaline/Dopamine ELISA Kit (3-CAT)
<p>Adrenaline/Noradrenaline/Dopamine ELISA Kit for the rapid quantitative determination of Adrenaline/Noradrenaline/Dopamine in plasma</p>Pureza:Min. 95%Human IL6 ELISA Kit
<p>ELISA kit for detection of Human IL6 in the research laboratory</p>Pureza:Min. 95%Head activator
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C54H84N12O14Peso molecular:1,125.36 g/molAc-Ala-Ala-Ala-pNA
CAS:<p>Ac-Ala-Ala-Ala-pNA is a synthetic peptide that is derived from the natural amino acid sequence of cholecystokinin. It has been shown to have high affinity for phospholipid bilayers, which are lipid membranes that form the boundaries of cells and organelles. Ac-Ala-Ala-Ala-pNA can be used as a substrate molecule to study membrane permeability and selectivity in bioreactors. Ac-Ala-Ala-Ala-pNA also acts as a modulator of liposomal membranes, increasing the permeability of these membranes in order to allow more substrate molecules to pass through them.</p>Fórmula:C17H23N5O6Pureza:Min. 95%Forma y color:PowderPeso molecular:393.39 g/mol05:0 PC
CAS:<p>05:0 PC is a peptide binding sequence that has been shown to inhibit the replication of viral sequences. 05:0 PC binds to the amino acid sequence in protein, which is a model system for peptide binding. The endoplasmic reticulum, or ER, is the site of synthesis for proteins and its low efficiency may be due to the spontaneous nature of the protein synthesis process. The ER can also be seen as an inhibitor molecule that prevents the virus from replicating. 05:0 PC has been shown to inhibit papillomavirus and HIV-1 replication in vitro. This peptide has also been shown to block interactions between viruses and cells that allow viral replication.</p>Fórmula:C18H36NO8PPureza:Min. 95%Peso molecular:425.45 g/molRef: 3D-RCA41434
Producto descatalogadoProlactin Releasing Peptide (1-31), bovine
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C157H244N54O41SPeso molecular:3,576.01 g/molMyelin Oligodendrocyte Glycoprotein (35-55) (mouse, rat) trifluoroacetate
CAS:<p>Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.</p>Fórmula:C118H177N35O29S•C2HO2F3Pureza:Min. 95%Forma y color:PowderPeso molecular:2,695.98 g/molRef: 3D-FM109206
Producto descatalogadoCJC-1295
CAS:<p>CJC-1295 is a synthetic peptide, which is an analogue of growth hormone-releasing hormone (GHRH). It is synthesized through recombinant DNA technology, which allows for precise control over its sequence and length. This particular peptide is designed to bind to GHRH receptors in the pituitary gland. By activating these receptors, CJC-1295 stimulates the release of growth hormone (GH) into the bloodstream.The primary function of CJC-1295 is to influence the endocrine system, particularly enhancing the release of endogenous growth hormone. It achieves this by increasing the amplitude and frequency of GH pulses without affecting the natural negative feedback mechanisms that regulate GH production. This mode of action distinguishes CJC-1295 from other growth hormone therapies, as it promotes a more physiological pattern of hormone secretion.CJC-1295 is used in various scientific contexts, primarily in research focusing on growth hormone deficiencies, muscle wasting conditions, and certain metabolic disorders. Its ability to increase GH release also makes it a subject of interest in studies related to aging, tissue repair, and regeneration. The longer half-life of CJC-1295 compared to natural GHRH peptides further enhances its applications in research, allowing for more sustained and controlled experimentation.</p>Pureza:Min. 95%Ref: 3D-FC138107
Producto descatalogado[Ala81]-MBP (74-85)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C55H94N20O21Peso molecular:1,371.48 g/molMesotocin trifluroacetate
CAS:<p>Mesotocin is a peptide hormone that has a role in the regulation of water permeability and estradiol benzoate. It also regulates the physiological functions of the brain and has been shown to be involved in congestive heart failure, as it causes an increase in blood pressure. Mesotocin is found at high levels in human serum, but its activity is dependent on the presence of other hormones such as estradiol benzoate. The biological properties of mesotocin are largely unknown, although it is known to have receptor activity. The effects of this hormone on the kidney have been studied using mesotocin trifluroacetate (MTFA) and monoclonal antibody (mAb). MTFA causes an increase in glomerular filtration rate (GFR), which may be due to its ability to inhibit angiotensin II-induced vasoconstriction and decrease vascular resistance.</p>Fórmula:C43H66N12O12S2Pureza:Min. 95%Peso molecular:1,007.19 g/molRef: 3D-FI108690
Producto descatalogadoPAR-1-selective peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C35H58N10O9Peso molecular:762.91 g/molH-His-Arg-OH
CAS:<p>H-His-Arg-OH is a synthetic peptide that has been shown to have cytotoxic effects on mammalian cells. The H-His-Arg-OH peptide can be used for the treatment of heart disease and autoimmune diseases, such as rheumatoid arthritis. This peptide has been found to be resistant to congestive heart failure, which is caused by a number of factors, including hypertension and valvular stenosis. It has also been shown to have an immunoglobulin G1 (IgG1) genotype.</p>Fórmula:C12H21N7O3Pureza:Min. 95%Peso molecular:311.34 g/molRef: 3D-FH108062
Producto descatalogadoAmyloid beta-Protein (36-38)
CAS:<p>Amyloid beta-Protein (36-38) is a peptide that has molecular weight of 4.3 kDa. It is a fragment of amyloid precursor protein, which is cleaved by enzymes in the brain to create the peptide. Amyloid beta-Protein (36-38) has been found to be involved in Alzheimer's disease as it aggregates into β-sheet bundles and forms amyloid plaques in the brain. This protein can be detected using vibrational spectroscopy and has been observed to have a strain that changes depending on pH. This molecule also undergoes proteolysis by peptidases, which break down proteins into amino acids for analysis with an amino acid analyzer. The solute can be analyzed with an acid analysis or spectrometer, which are used to determine functional groups such as carboxylic acids, hydroxyls, or amides. Amyloid beta-Protein (36-38)</p>Fórmula:C9H17N3O4Pureza:Min. 95%Peso molecular:231.25 g/molRef: 3D-FA109475
Producto descatalogado
