Compuestos y reactivos bioquímicos

<p>Ubiquitin antibody was raised in mouse using purified bovine erythrocyte ubiquitin as the immunogen.</p>

<p>Peptide H-YTNWIQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Afamelanotide acetate is a human protein that acts as a kinase inhibitor. It is derived from d-xylose and has been shown to have anticancer properties. Afamelanotide acetate inhibits the activity of kinases, which are enzymes that play a crucial role in tumor growth and progression. This drug induces apoptosis, or programmed cell death, in cancer cells and has been shown to be effective against various types of cancer, including Chinese hamster ovary (CHO) cells. Afamelanotide acetate has also been found in human urine and may have potential as a biomarker for cancer diagnosis or monitoring.</p>

<p>Peptide H-TVVTQF^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Fulvestrant is an estrogen receptor antagonist that is used in the treatment of HR+ breast cancer. This drug can be used as monotherapy or in combination with Alpelisib. Fulvestrant works both by down-regulating and by degrading the estrogen receptor.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-SWTWEGNKWTWK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-IVG^G^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>HSV1 + HSV2 ICP27 antibody was raised in mouse using herpes simplex virus regulatory ICP27 as the immunogen.</p>

<p>H-GLEIDVTDFK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GLEIDVTDFK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GLEIDVTDFK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GLEIDVTDFK-OH at the technical inquiry form on this page</p>

<p>Peptide H-TITSSYYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-NTTCVNWNQY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The Testosterone antibody is a monoclonal antibody used in the field of Life Sciences. It is a highly reactive antibody that specifically targets and inhibits the activity of androgen hormones. This antibody has been shown to neutralize the effects of testosterone, which plays a crucial role in various biological processes. Additionally, it has been found to inhibit enzymes such as tyrosinase and interfere with the production of interferon. The colloidal nature of this antibody allows for easy application and efficient binding to target molecules. Whether used in research or therapeutic applications, the Testosterone antibody offers a powerful tool for studying and manipulating hormonal pathways.</p>

<p>Please enquire for more information about Anti-OOEP antibody - 0.5mg/ml including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-YEALLLGGLPQEGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-NDGYLMFQQVPMVEIDGMK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-AVIFM-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-AVIFM-OH is provided at greater that Crude (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-AVIFM-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-AVIFM-OH at the technical inquiry form on this page</p>

<p>H-LNLFSLDPDIDTLK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LNLFSLDPDIDTLK-OH is provided at greater that Flashpure (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LNLFSLDPDIDTLK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LNLFSLDPDIDTLK-OH at the technical inquiry form on this page</p>

<p>Peptide H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>HBeAg antibody was raised in mouse using hepatitis B virus as the immunogen.</p>

<p>Salmonella antibody (LPS core) was raised in mouse using LPS core of Salmonella as the immunogen.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-DIQMTQSPSSLSASVGDRVTITCR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-HMTEVVR^HC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Cymit Quimica provides this product solely for uses within the scope of any statute or law providing for an immunity, exemption, or exception to patent infringement (“Exempted Uses”), including but not limited to 35 U.S.C. § 271(e)(1) in the United States, the Bolar type exemption in Europe, and any corresponding exception to patent infringement in any other country. It is the sole responsibility of the purchaser or user of this product, and the purchaser or user of this product agrees to engage only in such Exempted Uses, and to comply with all applicable intellectual property laws and/or regulations. The purchaser of this product agrees to indemnify Cymit Quimica against all claims in connection with the performance of the respective commercial agreement (e.g. supply agreement) and possible infringements of intellectual property rights.</p>

<p>H-LVTTGSPIS-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LVTTGSPIS-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LVTTGSPIS-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LVTTGSPIS-OH at the technical inquiry form on this page</p>

<p>Goat anti-rat IgG/IgA/IgM (H+L) was raised in goat using rat IgG, IgA and IgM whole molecules as the immunogen.</p>

<p>Conjugated Benzoylecgonine-BSA hapten</p>

<p>Peptide H-SP^YQLVLQHSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-EMPSEEGYQDYEPEA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>GPX4 antibody was raised using a synthetic peptide corresponding to a region with amino acids QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAA</p>

<p>Peptide H-FQSGQVLAALPRTSR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Goat anti Human IgG antibody was raised in goat using human IgG F(c) fragment as the immunogen.</p>

<p>Peptide Ac-LAEYHAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>A kit for releasing EVs from their bound state with the Vn96 peptide.</p>

<p>29-227 amino acids: MLPICPGGAA RCQVTLRDLF DRAVVLSHYI HNLSSEMFSE FDKRYTHGRG FITKAINSCH TSSLATPEDK EQAQQMNQKD FLSLIVSILR SWNEPLYHLV TEVRGMQEAP EAILSKAVEI EEQTKRLLEG MELIVSQVHP ETKENEIYPV WSGLPSLQMA DEESRLSAYY NLLHCLRRDS    HKIDNYLKLL KCRIIHNNNC</p>

<p>Mouse monoclonal CSPS antibody</p>

<p>H-VSAADICGL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VSAADICGL-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VSAADICGL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VSAADICGL-OH at the technical inquiry form on this page</p>

<p>Peptide LCBiot-HMRSAMSGLHLVKRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Chlamydia antibody is a monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and detect Chlamydia, a common sexually transmitted infection. This antibody has been extensively tested and proven to have high specificity and sensitivity in detecting Chlamydia antigens in various samples. It works by binding to specific proteins expressed by the Chlamydia bacteria, allowing for accurate identification and diagnosis of the infection.</p>

<p>The Vancomycin antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and binds to mesothelin, an antigen expressed on the surface of certain cancer cells. This antibody has been extensively studied and proven to be effective in inhibiting the growth and spread of cancer cells by blocking the interaction between mesothelin and its receptor. In addition to its anti-cancer properties, the Vancomycin antibody has also shown potential in other therapeutic applications, such as targeted drug delivery and imaging. Its unique binding characteristics make it a valuable tool for researchers and clinicians working in various fields of study, including oncology, immunology, and drug development.</p>

<p>Influenza A Virus Nucleoprotein Recombinant Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Influenza A Virus Nucleoprotein Recombinant Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Please enquire for more information about Hepcidin-25 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-RVCMTLDGVLNKECC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-RVCMTLDGVLNKECC-OH is provided at greater that &gt;80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-RVCMTLDGVLNKECC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-RVCMTLDGVLNKECC-OH at the technical inquiry form on this page</p>

<p>Anti-GLP1R antibody</p>

<p>The Influenza B antibody is a neutralizing antibody that is activated upon binding to the influenza virus. It specifically targets the glutamate region on the virus surface, preventing its attachment to host cells and subsequent infection. The antibody is immobilized on a cellulose matrix, which allows for easy purification and handling. Additionally, it has been conjugated with phalloidin, a cytotoxic compound that enhances its efficacy against the virus. This antibody has been extensively tested in human serum and has shown high specificity and affinity for the influenza B virus. It is widely used in Life Sciences research for studying viral replication, as well as in diagnostic assays for detecting influenza infections. The monoclonal antibodies are produced using advanced techniques and are of high purity and quality. Each batch undergoes rigorous quality control tests to ensure consistent performance. The electrode used for immobilization is made of high-quality materials to ensure stability and reliability. Furthermore, the antibody has low affinity for serum albumin, minimizing non-specific binding and</p>

<p>Turkey Red Blood Cells are biospecimens that can be used for various research purposes. They are commonly used in neutralizing assays, interferon assays, and monoclonal antibody binding studies. These blood cells contain globulin and other binding proteins, making them useful for studying the interaction between antibodies and antigens. Turkey Red Blood Cells have also been used in veterinary applications, such as testing the efficacy of anti-CD20 antibodies in animals. Additionally, they can be employed in liver microsome studies to assess drug metabolism and evaluate the effects of growth factors or excipients. Overall, Turkey Red Blood Cells are valuable tools for researchers investigating immune responses, antibody-drug interactions, and various other areas of study.</p>