Compuestos y reactivos bioquímicos

<p>Goat anti-Human IgG (H + L) was raised in goat using purified Human IgG (H&amp;L) as the immunogen.</p>

<p>Thyroid Peroxidase antibody is a protein that plays a crucial role in the synthesis of thyroid hormones. It is an autoantibody that targets thyroid peroxidase, an enzyme involved in the production of thyroid hormones. This antibody specifically binds to the enzyme and inhibits its activity, leading to reduced hormone synthesis. Thyroid Peroxidase antibody has been extensively studied in the field of Life Sciences, particularly in relation to hepatocyte growth factor (HGF) signaling pathway. It has been shown that this antibody can interfere with HGF signaling by binding to HGF dimers and preventing their interaction with receptors on target cells. Furthermore, low-molecular-weight antibodies have been identified as cytotoxic against thyroid cells, leading to cell death and disruption of hormone production. Monoclonal Antibodies targeting Thyroid Peroxidase have also been developed for therapeutic use, such as neutralizing antibodies against angiopoietin-like 3 (ANGPTL3), which have shown promising</p>

<p>Erythropoietin-alpha protein containing 165 amino acids.</p>

<p>Proteinase 3 antibody was raised in rabbit using human leucocyte proteinase 3 as the immunogen.</p>

<p>The proBNP antibody is a highly specialized monoclonal antibody that specifically targets and binds to the amino-terminal region of proBNP (pro-B-type natriuretic peptide). This antibody is derived from a hybridoma cell line and has been extensively characterized for its specificity and reactivity. It is produced using bovine γ-globulin as the carrier protein, making it suitable for use in various applications.</p>

<p>EIF3M antibody was raised using the N terminal of EIF3M corresponding to a region with amino acids MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACD</p>

<p>Purified Native Astrovirus type 1 protein</p>

<p>ACTH antibody was raised in mouse using ACTH as the immunogen.</p>

<p>SMC1A antibody was raised in Rat using Mouse SMC1A and GST fusion protein as the immunogen.</p>

<p>The PTH Antibody is a life sciences product that is used for various applications. It is an antibody that specifically targets parathyroid hormone (PTH). Parathyroid hormone plays a crucial role in regulating calcium and phosphate levels in the body. This antibody can be used in research studies to investigate the function of PTH and its interactions with other molecules.</p>

<p>PSA antibody was raised in goat using purified human seminal fluid as the immunogen.</p>

<p>Myoglobin antibody was raised in mouse using human heart myoglobin as the immunogen.</p>

<p>MUC1 antibody was raised in hamster using a synthetic peptide corresponding to aa 239-255 (SSLSYTNPAVAATSANL) form the cytoplasmic tail of MUC1 as the immunogen.</p>

<p>Estrogen receptor antibody was raised in rabbit using a synthetic peptide from the N-Terminus of human estrogen receptor, alpha protein as the immunogen.</p>

<p>Alpha 1 Antichymotrypsin antibody was raised against Human Alpha-1-Antichymotrypsin.</p>

<p>The His Tag antibody is a highly reactive and specific monoclonal antibody that is widely used in Life Sciences research and immunoassays. This antibody is designed to specifically bind to the histidine-tagged proteins, allowing for easy detection and purification. The His Tag antibody has been extensively validated for its high affinity and specificity, making it an ideal choice for researchers working with histidine-tagged proteins. It can be used in various applications, including Western blotting, ELISA, immunoprecipitation, and flow cytometry. With its exceptional performance and reliability, the His Tag antibody is a valuable tool for scientists studying protein-protein interactions, protein expression levels, and protein localization. Trust the His Tag antibody to deliver accurate and reproducible results in your experiments.</p>

<p>Peptide H-FPDENFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>HCG antibody is a monoclonal antibody that specifically targets human chorionic gonadotropin (HCG). It has been widely used in life sciences research to study various aspects of HCG function. This antibody can neutralize the activity of HCG by binding to it and preventing its interaction with its receptors. Additionally, it has been shown to inhibit the growth of endothelial cells and adipocytes, suggesting potential therapeutic applications in conditions such as obesity and angiogenesis-related disorders. Furthermore, HCG antibody can be used as a diagnostic tool for detecting the presence of HCG in clinical samples, making it valuable in pregnancy testing and monitoring certain types of cancer. Its specificity and high affinity make it an essential tool for researchers and clinicians working in the field of reproductive biology and endocrinology.</p>

<p>Peptide Ac-GRGDSP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Chicken IgY is a purified immunoglobulin that is derived from chicken serum. It is commonly used in the field of life sciences for various applications, including immunoassays and antibody-based research. Chicken IgY exhibits high specificity and affinity for its target antigens, making it an excellent tool for detecting and quantifying specific antibodies or proteins. This purified immunoglobulin can be conjugated with various labels, such as colloidal gold, to facilitate visualization in assays. Chicken IgY is also known for its neutralizing properties against autoantibodies and chimeric proteins. With its unique structure and amino acid residues, Chicken IgY offers researchers a reliable and versatile tool for studying immune responses in human serum or other biological samples.</p>

<p>Hemoglobin A1c control is a highly effective biological reagent used in the field of life sciences. It is a monoclonal antibody that specifically targets interleukin-6, a key cytokine involved in various cellular processes. This control solution contains chimeric proteins and antibodies that have been engineered to bind with high affinity to the target molecule.</p>

<p>The Human IgA antibody is a potential biomarker that has various applications in the field of Life Sciences. It is a monoclonal antibody that specifically targets anti-ganglioside antibodies. This antibody can be used in research and diagnostic settings to detect and measure the levels of anti-ganglioside antibodies in human hepatocytes.</p>

<p>Purified Turkey IgG FITC conjugate</p>

<p>Goat anti-human IgG (FITC) was raised in goat using human IgG F(c) as the immunogen.</p>

<p>ARRB2 antibody was raised in Rabbit using Human ARRB2 as the immunogen</p>

<p>Purified recombinant Human HFE protein (His tag)</p>

<p>Nitrogen mustard derivative; DNA crosslinking agent; anti-cancer agent</p>

<p>Peptide Ac-VALDPIDISIVLNKIKSDLEESKEWIRRSNKILDSI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Purified rabbit polyclonal SIGLEC1 antibody</p>

<p>Thrombin antibody (HRP) was raised in sheep using Thrombin prepared from purified human Prothrombin as the immunogen.</p>

<p>The FSH antibody is a monoclonal antibody that targets the follicle-stimulating hormone (FSH), a growth factor present in human serum. This antibody has been extensively studied and shown to have high specificity and affinity towards FSH. It can be used for various applications in the field of life sciences, including research, diagnostics, and therapeutic development.</p>

<p>Cyclin E antibody was raised in rabbit using a synthetic peptide derived from the c-terminus of human cyclin E as the immunogen.</p>

<p>ApoA-II antibody was raised in goat using human apolipoprotein A-II as the immunogen.</p>

<p>Chlamydia trachomatis antibody was raised in mouse using Chlamydia LGV2 as the immunogen.</p>

<p>C-myc antibody was raised in mouse using recombinant c-myc protein as the immunogen.</p>

<p>The Listeria antibody is a monoclonal antibody specifically designed for use in Life Sciences. It is used in various applications such as electrode-based assays and peroxidase conjugate-based assays. This antibody is highly effective in detecting and targeting Listeria, a bacterium responsible for causing foodborne illnesses. The Listeria antibody can be utilized in biomolecule analysis, polymerase chain reaction (PCR) experiments, and flow cytometry detection. Its high surface affinity ensures accurate and reliable results. This antibody is also activated against other target molecules, making it a versatile tool for research purposes. With its exceptional performance and specificity, the Listeria antibody is an essential component in the development of new antimicrobial agents and diagnostic tests.</p>

<p>Goat anti-human IgG (Fab'2) (FITC) was raised in goat using human IgG F(c) fragment as the immunogen.</p>

<p>Donkey anti-sheep IgG (H+L) (Rhodamine) was raised in donkey using sheep IgG, whole molecule as the immunogen.</p>

<p>H-WNSSWSNKSLDKIWN-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-WNSSWSNKSLDKIWN-OH is provided at greater that &gt;80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-WNSSWSNKSLDKIWN-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-WNSSWSNKSLDKIWN-OH at the technical inquiry form on this page</p>

<p>Amyloid P antibody was raised in goat using purified human amyloid P component as the immunogen.</p>

<p>Toxoplasma gondii protein is a native protein that plays a crucial role in the Life Sciences field. It has been found to regulate erythropoietin and nucleotide levels, making it an important molecule for cellular functions. This protein has also been shown to have an impact on cardiomyocytes, affecting their structure and function. Researchers have developed monoclonal antibodies specifically targeting this protein, allowing for precise detection and analysis in various assays. The chemical structure of Toxoplasma gondii protein is well-studied, enabling scientists to understand its interactions with other molecules and its role as a serum marker. Its reactivity with cellulose-based materials makes it an ideal target for purification processes in research laboratories. Overall, the Toxoplasma gondii protein is a valuable tool in the study of cellular processes and disease mechanisms within the Life Sciences field.</p>

<p>Anti-Feline Leukemia Virus antibody</p>

<p>Cyclin D2 antibody was raised in mouse using purified human recombinant full-length cyclin D2 protein as the immunogen.</p>

<p>Peptide H-YGLVTYATYPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Purified Goat IgG (Fab) HRP conjugate</p>

<p>Peptide H-SSGLVSNAPGVQIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The Anti-CPV Antibody is a glycopeptide that belongs to the class of glycoproteins in the Life Sciences field. It is specifically designed to target and neutralize Canine Parvovirus (CPV). This monoclonal antibody has high affinity for CPV and can effectively inhibit its binding to host cells, preventing viral entry and replication.</p>

<p>Insulin antibody was raised in mouse using human insulin as the immunogen.Insulin is a hormone produced by the pancreas, specifically by clusters of cells called islets of Langerhans. It plays a crucial role in regulating blood glucose (sugar) levels by facilitating the uptake of glucose into cells, allowing them to use it for energy or store it for later use in the form of glycogen in the liver and muscles.</p>

<p>The hPL antibody is a highly specialized Monoclonal Antibody that is activated and used in Life Sciences research. It is designed to specifically target and bind to the drug antibody present in human hepatocytes. This antibody has cytotoxic properties, making it an effective tool for studying the effects of drugs on liver cells. Additionally, the hPL antibody is reactive towards glycan, carbonic, natriuretic, and glycoprotein targets, making it a versatile tool for various research applications. Its high specificity and affinity make it an ideal choice for researchers looking to study the role of these targets in different biological processes. Furthermore, this antibody has been shown to have inhibitory effects on TGF-beta1 signaling pathway, providing valuable insights into its role in cell growth and development.</p>

<p>Purified recombinant Chimeric Chagas protein</p>