Compuestos y reactivos bioquímicos

<p>Peptide H-ASHLGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-IQDQLQLFR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-IQDQLQLFR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-IQDQLQLFR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-IQDQLQLFR-OH at the technical inquiry form on this page</p>

<p>Peptide Ac-IEGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The renin angiotensin system (RAS), consists of many angiotensin peptides involved in regulating functions such as blood pressure, cardiovascular function and energy balance. RAS activity is elevated in obesity and RAS is widely studied in relation to lifestyle-related diseases.Angiotensin I (Ang-I), is the first angiotensin to be produced upon activation of the RAS system. It is produced by the cleavage of angiotensinogen (AGT), catalysed by the aspartylprotease, renin. The dicarboxyl-peptidase angiotensin converting enzyme (ACE), then removes two amino acids from the C-terminus of Ang-I to form angiotensin II (Ang-II), and His-Leu.Ang-I is also converted to Ang-II by chymase, especially in the human heart. The chymase pathway is important in inflammatory conditions.</p>

<p>TIMP2 antibody was raised in rabbit using a synthetic peptide based on the carboxy-terminus of the human TIMP-2 sequence as the immunogen.</p>

<p>Peptide H-RGFFYTPKTR^RE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Quinapril is an angiotensin-converting enzyme (ACE) inhibitor prodrug that is used to treat hypertension and congestive heart failure. It blocks the conversion of angiotensin I to angiotensin II, resulting in vasodilation which lowers blood pressure.</p>

<p>Peptide H-MHVAQPAVVLASSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Surfactant 10G is a versatile product widely used in the Life Sciences industry. It acts as a drug antibody and is commonly used in buffers for neutralizing purposes. Surfactant 10G has been proven to effectively regulate plasma levels of teriparatide, fibrinogen, and alpha-gal antibodies. It is also a reliable test substance for monoclonal antibodies and phosphatase binding proteins.</p>

<p>Peptide H-YPDAVATWLKPDPSQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Vardenafil is a phosphodiesterase type 5 inhibitor that binds to intracellular targets and competitively inhibits cyclic guanosine monophosphate (cGMP) hydrolysis thus increasing cGMP levels. Vardenafil can be used for the research of erectile dysfunction, hepatitis and diabetes.</p>

<p>Peptide Ac-PRRYSPVAKDLLGEEDIC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The GMCSF antibody is a monoclonal antibody that specifically targets and inhibits the action of granulocyte-macrophage colony-stimulating factor (GM-CSF). GM-CSF is a growth factor that plays a crucial role in the development and function of white blood cells, particularly granulocytes and macrophages. By blocking the interaction between GM-CSF and its receptors, this antibody effectively suppresses the production and activation of these immune cells.</p>

<p>Perospirone is an atypical antipsychotic of the azapirone family that is used to diagnose and treat certain mental disorders. It works by blocking certain receptors in the brain, which may be related to the symptoms of anxiety, depression, or schizophrenia. Perospirone has been shown to have inhibitory properties on the papillary muscle and anterior cingulate cortex. This medication is metabolized through several metabolic transformations, including polymerase chain reactions and blood sampling.</p>

<p>Peptide H-QDGNEEM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Purified native Human Fibrinogen protein</p>

<p>Ibrutinib is a small-molecule inhibitor of Bruton’s tyrosine kinase, a crucial enzyme to the B-cell receptor pathway. Bruton’s tyrosine kinase becomes continuously activated in B-cell cancers and therefore promotes the survival of tumor cells. Ibrutinib binds irreversibly and covalently to a cysteine residue within the ATP-binding site of the enzyme, thus preventing ATP binding and downstream signal transduction. The ability of Ibrutinib to inhibit Bruton’s tyrosin kinase and hence the B-cell receptor pathway it can be used in the treatment of some B cell cancers such as diffuse large B-cell lymphoma (DLBCL) and chronic lymphocytic leukemia (CLL).</p>

<p>Peptide Fluor-YGG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>E. coli antibody was raised in rabbit using a mixtures of all antigenic serotypes as the immunogen.</p>

<p>Peptide H-VGDGTVIL^^K^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide LCBiot-GHSFADPASNLGLEDIIRKALMGSF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds with bactericidal activity. This drug works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, preventing transcription and replication. The effectiveness of this drug has been proven through extensive testing using the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it has the ability to bind to markers expressed in high levels in Mycobacterium tuberculosis strains and inhibit cell growth in culture.</p>

<p>Peptide H-R^MFPNAPYL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>CEA antibody was raised in mouse using purified natural CEA as the immunogen.</p>

<p>Peptide H-VGAHAGEYGAEALER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>MK-0812 succinate is a synthetic pharmaceutical compound, which is a product of chemical synthesis with high purity standards suitable for therapeutic use. This compound is synthesized from raw chemical materials using controlled reactions to ensure specific molecular characteristics and potency. MK-0812 succinate functions by inhibiting specific biological pathways that are implicated in disease progression, primarily by binding to target proteins and altering their function. This action results in modulation of cellular processes that contribute to the pathophysiology of certain diseases.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>FCER1A antibody was raised using the middle region of FCER1A corresponding to a region with amino acids IYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNIT</p>

<p>The HE4 protein is a monoclonal antibody that acts as an antigen and plays a crucial role in various biological processes. It is involved in regulating glucagon and growth factor activity, making it essential for maintaining homeostasis in the body. The HE4 protein is widely used in the field of Life Sciences for research purposes, specifically in studies related to Native Proteins &amp; Antigens.</p>

<p>Peptide H-GLEWVGAIYPGNGDTSYNQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The resin is used for the synthesis of peptides and other small molecules. The resin is a polystyrene-divinylbenzene copolymer that is functionalized with an amino acid sequence. It can be used in automated peptide synthesizers to perform solid phase peptide synthesis.</p>

<p>Conjugated Methadone-BSA hapten</p>

<p>Peptide Ac-AEEE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Influenza B antibody was raised in mouse using a nuclear protein from the Singapore strain of influenza B as the immunogen.</p>

<p>Influenza B antibody was raised in mouse using Influenza B as the immunogen.</p>

<p>Vandetanib is antineoplastic kinase inhibitor that binds to the ATP-binding site of the enzyme squamous cell carcinoma kinase (SQSTM1). This binding inhibits the phosphorylation of the Bcl-2 protein and causes apoptosis. Vandetanib has been shown to have an effect on polymerase chain reaction amplification, terminal erythrocyte differentiation, and on gene expression in human tissue.</p>

<p>Peptide H-EYQDLLNVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VGEFSGANK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Please enquire for more information about N-(3-Sulfo)succinimidyl-p-formylbenzoate sodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Please enquire for more information about Alloferon 1 trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about PR-104  including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about IDR 1002 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dengue type 4 antibody was raised in mouse using dengue type 4, (H241), as the immunogen.</p>

<p>H-VMNVPDFDFPPEFYEHAKAL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VMNVPDFDFPPEFYEHAKAL-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VMNVPDFDFPPEFYEHAKAL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VMNVPDFDFPPEFYEHAKAL-OH at the technical inquiry form on this page</p>

<p>H-GLFLPEDENLR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GLFLPEDENLR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GLFLPEDENLR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GLFLPEDENLR-OH at the technical inquiry form on this page</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Region of TGF beta 1 protein corresponding to amino acids ALDTNYCFSS TEKNCCVRQL YIDFRKDLGW KWIHEPKGYH ANFCLGPCPY IWSLDTQYSK VLALYNQHNP GASAAPCCVP QALEPLPIVY YVGRKPKVEQ LSNMIVRSCK CS.</p>

<p>Peptide Methyltetrazine-AGYLLGKINLKALAALAKKIL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>