Compuestos y reactivos bioquímicos
Los bioquímicos y reactivos son sustancias fundamentales para la investigación y el desarrollo en campos como la biotecnología, la biología molecular, la farmacología y la medicina. Estos productos son esenciales para una variedad de aplicaciones, incluyendo la síntesis de compuestos, el análisis de muestras biológicas, la investigación de procesos metabólicos y la producción de medicamentos. En CymitQuimica, ofrecemos una amplia selección de bioquímicos y reactivos de alta calidad y pureza, adecuados para diversas necesidades científicas e industriales. Nuestro catálogo incluye enzimas, anticuerpos, ácidos nucleicos, aminoácidos, y muchos otros productos, todos diseñados para apoyar a los investigadores y profesionales en sus proyectos de investigación y desarrollo, asegurando resultados confiables y reproducibles.
Subcategorías de "Compuestos y reactivos bioquímicos"
- Biomoléculas(99.130 productos)
- Por objetivo biológico(99.159 productos)
- Según efectos farmacológicos(6.787 productos)
- Crioconservantes(21 productos)
- Desinfectantes y compuestos relacionados(28 productos)
- Hormonas(346 productos)
- Biología Vegetal(6.747 productos)
- Metabolitos secundarios(14.222 productos)
Se han encontrado 130579 productos de "Compuestos y reactivos bioquímicos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Click pVec
<p>pVEC is an amphipathic cell-penetrating peptide (CPP). This CPP is derived from murine vascular endothelial cadherin, which is able to cross the blood brain barrier. pVec can permeate cell membrane at low micromolar concentration and mostly localising to the nucleus but is also found throughout the cell. Importantly, pVec shows efficient cellular uptake when carrying large molecular cargo making it a highly potent transporter for drug delivery.pVec is provided here with a N-terminal alkyne attachment. Two of the most regularly encountered functional groups for click chemistry are azides and alkynes, and the azide-alkyne cycloaddition has become the most popular click reaction. The use of click chemistry with alkyne-pVec allows a wide variety of applications particularly for conjugation, modification, and peptide design.</p>Forma y color:PowderPeso molecular:2,287.4 g/molAc-CAEAETAKDN-OH
<p>Peptide Ac-CAEAETAKDN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GEGIEEFLR^-OH
<p>Peptide H-GEGIEEFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PGP-NH2
<p>Peptide H-PGP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QVSSHIQVLAR^-OH
<p>Peptide H-QVSSHIQVLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Pureza:Min. 95%Goat anti Rabbit IgG (HRP)
<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>Pureza:Min. 95%H-ELVVDFLSYK^-OH
<p>Peptide H-ELVVDFLSYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
<p>Exendin-4 is a 39-amino acid peptide incretin mimetic. Exendin-4, also known as Exenatide, was originally isolated from the venom of Gila monster lizard called Heloderma suspectum1. Exendin-4 is a long-acting analog of the mammalian intestinal hormone glucagon-like peptide I (GLP-1) and therefore exhibits glucoregulatory activities to control plasma glucose levels2. Exendin-4 enhances insulin synthesis and secretion in a glucose-dependent manner, while downregulating inappropriately high glucagon release, slowing gastric emptying and decreasing appetite2. The increase in maximum insulin secretion is due to a greater increase in cAMP production in pancreatic β cells3. Exendin-4 is a potent agonist of the Glucagon-Like Peptide-1 Receptor (GLP-1R ; Kd = 136pM).</p>H-VFNHFYNI-OH
<p>H-VFNHFYNI-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VFNHFYNI-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VFNHFYNI-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VFNHFYNI-OH at the technical inquiry form on this page</p>Pureza:Min. 95%Musk active human
CAS:<p>Musk active human is a natural substance that belongs to the group of fatty acids. It is found in the musk gland of various animals, including deer, beaver, and otter. Musk active human has been shown to regulate protein glycosylation, which is important for biological function. Musk active human's function in the endoplasmic reticulum is to stabilize proteins and control the process of protein synthesis. A study on an acetylcholine receptor found that it can activate tyrosine kinase, which leads to pathogenic mechanisms. This compound has been expressed in a variety of tissues and seems to play a role in muscle activity. A silico analysis has also shown that this chemical may inhibit the production of sulfoxide through its interaction with enzymes such as cyclooxygenase-2.</p>Pureza:Min. 95%PRF protein
<p>PRF protein is a growth factor that plays a crucial role in various biological processes. It is involved in glycosylation, which is the process of adding sugar molecules to proteins. In the field of Life Sciences, PRF protein is widely studied and utilized. Monoclonal antibodies specific to PRF protein have been developed for research purposes. Recombinant Proteins & Antigens containing PRF protein are available for purchase.</p>Pureza:Min. 95%H-AL^P^AP^IEK^-OH
<p>Peptide H-AL^P^AP^IEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>PLP (178-191)
CAS:<p>PLP(178-191) corresponds to amino acids 178 to 191 of the mouse ProteoLipid Protein (PLP).</p>Fórmula:C70H106N18O22SPeso molecular:1,583.8 g/molFz7-21
<p>Binds to the cysteine rich domain of the Frizzled 7 receptor and inhibits Wnt signalling in cultured cells and stem cell function in intestinal organoids.</p>Forma y color:PowderPeso molecular:1,794.8 g/molTriiodothyronine (Sodium salt)
<p>High purity (>99%) Triiodothyronine sodium salt</p>Pureza:99% By HplcH-DPIYFTGLASEPGAR^-OH
<p>Peptide H-DPIYFTGLASEPGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CA 125 protein
<p>CA 125 protein is a molecule drug that belongs to the class of monoclonal antibodies. It is used in the field of Life Sciences for various applications. CA 125 protein specifically targets a molecule called TNF-α, which is a growth factor involved in inflammation and immune response. This protein can be used in research and diagnostic assays to detect and quantify TNF-α levels in biological samples. Additionally, CA 125 protein has been shown to have potential therapeutic applications in the treatment of certain diseases, such as cryptosporidium infection and autoimmune disorders. Its high specificity and affinity make it a valuable tool for studying the role of TNF-α in various physiological processes.</p>Pureza:>70%H-LSLEIEQLELQR^-OH
<p>Peptide H-LSLEIEQLELQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-R^FF-OH
<p>Peptide H-R^FF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LDLTLR-OH
<p>H-LDLTLR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LDLTLR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LDLTLR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LDLTLR-OH at the technical inquiry form on this page</p>Pureza:Min. 95%H-VGEVIVTK^-OH
<p>Peptide H-VGEVIVTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IQASFR^-OH
<p>Peptide H-IQASFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Leu-Enkephalin acetate
CAS:<p>Leu-Enkephalin is an endogenous opioid peptide that has been shown to produce analgesia, anti-inflammatory effects, and changes in locomotor activity. Leu-enkephalin binds to the kappa opioid receptor, which is found in high concentrations in the caudate putamen and hippocampal formation. The enkephalins are a family of basic proteins with two amino acids linked by a single amide bond. They are peptide hormones that act as neurotransmitters in the central nervous system and peripheral nervous system. Leu-enkephalin is a drug candidate for treatment of infectious diseases such as HIV and malaria. In addition, leu-enkephalin has been shown to have side effect profiles that are less severe than morphine or methadone.</p>Fórmula:C28H37N5O7·C2H4O2Pureza:Min. 95%Forma y color:PowderPeso molecular:554.64 g/molH-HVGDLGNVTADK^-OH
<p>Peptide H-HVGDLGNVTADK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Canine Distemper virus protein
<p>Canine Distemper virus protein is a vital component in the field of Life Sciences. This protein is widely used in research and diagnostic applications. It is known for its cytotoxic and neutralizing properties, making it an essential tool for studying the Canine Distemper virus. Monoclonal antibodies specific to this protein have been developed, allowing for precise targeting and detection. Additionally, the conformational epitope of this protein has been extensively studied, enabling researchers to gain insights into its structure and function. Canine Distemper virus protein can be used in various experimental setups, including studies on cyclase-activating peptide signaling pathways or the interaction with collagen and low-density lipoprotein receptors. When using this protein, it is recommended to handle it with care and follow proper safety protocols.</p>MART-1 26-35 (HLA-B*35:01)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-FATVVEELFR^-OH
<p>Peptide H-FATVVEELFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>ACTH (1-10) Human
<p>Amino acids 1-10 of human adrenocorticotropic hormone (ACTH). ACTH, also known as corticotropin, is a tropic hormone produced and secreted by the anterior pituitary gland and member of the melanocortins peptide family. ACTH is cleaved from the precursor proopiomelanocortin (POMC). ACTH is an important component of the hypothalamic-pituitary-adrenal (HPA) axis and is often produced in response to biological stress. ACTH acts to increase the production and release of cortisol via its interaction with the ACTH receptor- ACTHR, also known as melanocortin type 2 receptor (MC2R). Receptor activation increases the intracellular concentration of cAMP via adenylyl cyclase.Abnormal ACTH levels in the body has been linked to primary adrenal insufficiency/Addison's disease, Cushing's disease and secondary adrenal insufficiency.</p>Peso molecular:1,299.41 g/molSEQ ID NO:549
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Fórmula:C63H91N13O13Peso molecular:1,238.51 g/molRFRP-1 (Human)
CAS:<p>Neuropeptide:<br>Neuropeptides are small signaling molecules produced and released by neurons engaged in many physiological functions. Indeed, neuropeptides act on neural substrates such as G protein-coupled receptors (GPCRs), tyrosine-kinase receptor, insuline-like peptides and also ion channels. Actions of neuropeptides result in slow-onset, long-lasting modulation of synaptic transmission.<br>Pro-FMRFamide-related neuropeptide VF:<br>Pro-FMRFamide-related neuropeptide VF also called neuropeptide VF precursor are expressed in neurons in mediobasal hypothalamus. Neuropeptide VF precursor is a propeptide which is cleaved in three others peptide: Neuropeptide RFRP-1, RFRP-2 and RFRP-3.<br>Neuropeptide RFRP-1 (81-92):<br>Neuropeptide RFRP-1 play a role in the negative regulation of gonadotropin synthesis and secretion. Neuropeptide RFRP-1 is an agonist of the NPFF1 and NPFF2 receptors. In rats, Neuropeptide RFRP-1 increases prolactin release. Neuropeptide RFRP-1 (81-92) MPHSFANLPLRF-NH2 is a part of Neuropeptide RFRP-1 and is used to study NPFF receptors.</p>Fórmula:C67H101N19O14SPeso molecular:1,428.73 g/molH-MKLSEKNSAETKESC-NH2 PAB-405-1337F
<p>Peptide H-MKLSEKNSAETKESC-NH2 PAB-405-1337F is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVDALGNAIDGK^-OH
<p>Peptide H-VVDALGNAIDGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Nicotinamide - Bio-X ™
CAS:<p>Nicotinamide is a form of vitamin B that is found in food and it used to treat many conditions such as pellagra and acne. It replenishes cellular energy and has anti-inflammatory effects. Nicotinamide is an inhibitor of the enzyme SIRT1 in vitro but can be a stimulator in cells.</p>Fórmula:C6H6N2OPureza:Min. 98 Area-%Forma y color:PowderPeso molecular:122.12 g/molH-TSTSPIVK^-OH
<p>Peptide H-TSTSPIVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Polyproline-13
<p>Polyproline-13 (Pro13) forms a helix, and it is a naturally occurring secondary structure. Pro13 is used as a model peptide to help understand the folding mechanisms and intermediates of the proteome. Pro13 can exist in a cis-orientation leading to the formation of the right-handed PPI helix- this is more favourable in non-polar solvents. Alternatively, Pro13 can have a trans-orientation leading to a left-handed PPII helix favoured in polar solvents. Pro13 can interchange these forms by altering the solvent composition, as determined by circular dichronism spectroscopy. The ability to observe the reversible transition between PPI and PPII, and its intermediates, has been hampered by a lack of methodologies, and thus the mechanistic pathway remains unclear. There is PPII helix content in proteins, and the role that PPII conformations play in the non-structured state of polypeptides is still being investigated. Free energy landscapes of polyprolines in various solvents have helped to understand their relative stability and improve the information about the transition pathway between the helices.</p>Peso molecular:1,279.7 g/molH-LLAQTTLR^-OH
<p>Peptide H-LLAQTTLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Phosphorylated EGFR peptide substrate
<p>Phosphorylated EGFR peptide substrate.</p>Pureza:Min. 95%Peso molecular:1,700.8 g/molH-DVINEAWFPEDQR^-OH
<p>Peptide H-DVINEAWFPEDQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-NLRKSGTLGHPGSL-OH
<p>Peptide LCBiot-NLRKSGTLGHPGSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>(Gln²²,Asn²³)-Amyloid β-Protein (1-40)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Fórmula:C194H297N55O56SPeso molecular:4,327.9 g/molAc-CLSHPYLYAQLDGPR-NH2
<p>Peptide Ac-CLSHPYLYAQLDGPR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-TFG-OH
<p>Peptide Ac-TFG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Cathepsin D protein
<p>Cathepsin D protein is a cytotoxic protein that acts as an inhibitory factor in various biological processes. It can be targeted by anti-ACTH antibodies or monoclonal antibodies for research purposes in the field of Life Sciences. Cathepsin D protein plays a role in the degradation of extracellular matrix components such as fibronectin and collagen. It has also been studied for its interaction with tyrosinase, insulin, and antiphospholipid antibodies. This acidic protein is involved in processes related to transferrin and isothiocyanate metabolism. For researchers looking to study native proteins and antigens, Cathepsin D protein can be a valuable tool.</p>Pureza:> 98% PureSARS-CoV-2 Nucleoprotein (126-140)
<p>The coronavirus (CoV) nucleoprotein is the major component of CoV structural proteins. Also known as the nucleocapsid protein, it is an abundant RNA-binding protein critical for viral genome packaging. These factors make nucleoprotein a good target for developing new antiviral drugs. In addition, the identification of epitopes within the nucleoprotein sequence can help design more effective SARS-CoV-2 vaccines.Models have predicted epitopes exhibiting antigenicity, stability and interactions with MHC class-I and class-II molecules. Nucleoprotein (56-70) is an epitope candidate with various HLA restrictions. This epitope can be used to better vaccine design for more durable CD4+ and CD8+ T cell responses for long-lasting immunity.</p>Peso molecular:1,599.8 g/molSecretoneurin (rat)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Fórmula:C159H252N40O58Peso molecular:3,651.98 g/mol
