Compuestos y reactivos bioquímicos

<p>IFA Antibody Negative Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about IFA Antibody Negative Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Peptide H-WRWYCR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-IPESSELTLQELLGEERR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Toxoplasma Gondii Sonicated Antigen is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Toxoplasma Gondii Sonicated Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Candida Albicans IgG Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Candida Albicans IgG Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>PR3/CANCA Antibody Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about PR3/CANCA Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Bordetella Pertussis IgA Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Bordetella Pertussis IgA Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Factor H antibody was raised in goat using highly purified human complement protein as the immunogen.</p>

<p>Brucella Abortus IgG Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Brucella Abortus IgG Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>HEV IgM Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about HEV IgM Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Please enquire for more information about C.I.Reactive Violet 22 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>TM4SF4 antibody was raised using the N terminal of TM4SF4 corresponding to a region with amino acids CTGGCARCLGGTLIPLAFFGFLANILLFFPGGKVIDDNDHLSQEIWFFGG</p>

<p>CA 15-3 antibody was raised in mouse using human CA 15-3 antigen from a human cell line as the immunogen.</p>

<p>SMCC-DM1 is a cytotoxic drug conjugate component, which is a chemical compound derived from maytansine, a natural product isolated from the Ethiopian shrub *Maytenus serrata*. It primarily acts as a microtubule inhibitor by binding to tubulin, thereby disrupting the microtubule network within the cell, which results in cell cycle arrest and apoptosis.<br><br>This compound is particularly valuable in the field of targeted cancer therapy. In antibody-drug conjugates (ADCs), SMCC-DM1 serves as a payload linked to a monoclonal antibody specific to a tumor antigen. Upon binding to its target antigen on the cancer cell surface, the ADC is internalized and the cytotoxic agent is released, leading to selective destruction of cancerous cells while sparing healthy tissue. This targeted approach enhances therapeutic efficacy and minimizes systemic toxicity.<br><br>SMCC-DM1's robust mechanism of action and integration into ADCs make it a pivotal tool for researchers developing next-generation oncological treatments, offering significant potential in translating preclinical findings into clinical applications.</p>

<p>D-dimer Antibody Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about D-dimer Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Helicobacter Pylori is a gram-negative, helical bacterium that can penetrate the stomach's mucous lining to cause infection. It is a common cause of gastritis, peptic ulcers, and even stomach cancer in some cases. Cymit Quimica's Helicobacter Pylori Antigen is suitable for use in ChLIA assays.</p>

<p>HBc IgM Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about HBc IgM Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Please enquire for more information about C.I.Solvent Yellow 147 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Gliadin IgA Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Gliadin IgA Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Ribosomal RNP Antibody Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Ribosomal RNP Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>H. Pylori IgA/IgG Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about H. Pylori IgA/IgG Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Chlamydia Trachomatis IgG/IgA/IgM Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Chlamydia Trachomatis IgG/IgA/IgM Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>CMV IgM seroconversion panel 1 is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about CMV IgM seroconversion panel 1 including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Peptide H-VMAPRTLVL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-AVGVGKSAL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-SEQAAEAMEV-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SEQAAEAMEV-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SEQAAEAMEV-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SEQAAEAMEV-OH at the technical inquiry form on this page</p>

<p>Vitamin D Total, Biotin Conjugate is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Vitamin D Total, Biotin Conjugate including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>The BAP1 antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of Antibodies and has various applications in medicine. This monoclonal antibody specifically targets BAP1, a glycoprotein involved in multiple cellular processes.</p>

<p>Neisseria gonorrhoeae antibody is a monoclonal antibody that targets the EGF-like protein expressed by Neisseria gonorrhoeae, the bacteria responsible for gonorrhea. This antibody specifically binds to the EGF-like protein, preventing its interaction with host cells and neutralizing its activity. It has also been shown to inhibit the growth of other bacteria, such as Mycoplasma genitalium. Additionally, this antibody has cytotoxic effects on infected cells, leading to their destruction. The use of Neisseria gonorrhoeae antibody in clinical settings can aid in the diagnosis and treatment of gonorrhea and related infections.</p>

<p>Streptococcus Group A Rabbit Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Streptococcus Group A Rabbit Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Transferrin protein is a versatile biomolecule that plays a crucial role in iron transport and metabolism. It is a glycosylated protein that binds to iron ions and transports them throughout the body, ensuring their delivery to cells that require them for various biochemical processes. Transferrin protein has also been extensively studied in the field of medicine, particularly in the development of monoclonal antibodies for therapeutic purposes.</p>

<p>Ac-CSRPSPFDLFIRKS-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CSRPSPFDLFIRKS-NH2 is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CSRPSPFDLFIRKS-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CSRPSPFDLFIRKS-NH2 at the technical inquiry form on this page</p>

<p>Carbonic anhydrase II antibody was raised in rabbit using carbonic anhydrase II from human Erythrocytes as the immunogen.</p>

<p>Peptide H-TGAQELLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The Beclin-1 peptide is derived from a region of the Beclin-1 protein, which interacts with a newly identified negative regulator of autophagy, GAPR-1 (also called GLIPR2) to act as a potent inducer of autophagy. Autophagy is an essential process that maintains cellular homeostasis and carries out lysosome-mediated degradation of unwanted proteins in the cytoplasm. It is often examined when looking at disease pathways because of this regulatory function. While the immune system initiates the removal of viruses and pathogens through the autophagic pathway, some viruses (such as HIV) are able to evade this process.</p>

<p>Peptide H-REEEDK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The octapeptide cholecystokinin (26-33), known as CCK-8, has the full biological activity of the full-length cholecystokinin (CCK). CCK acts as a hormone and neurotransmitter and is found in the GI and central nervous systems. CCK-8 is a satiety peptide that inhibits food intake.CCK-8 can also inhibit amanitin uptake into hepatocytes.</p>

<p>E7046 is a potent antitumor agent that belongs to the class of immunomodulators. It has been shown to have immunomodulatory effects in mice with tumor cells, as well as potent anti-tumor activity in mouse and human cervical cancer cell lines. E7046 has also been found to induce collagen production in mice and inhibit collagenase, an enzyme that breaks down collagen. E7046 has also been shown to be effective against HIV infection, which may be due to its ability to inhibit viral replication by inhibiting transcription and DNA synthesis.</p>

<p>Peptide H-VAAEDWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-NNEKLPTLKNVQDCL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-NNEKLPTLKNVQDCL-OH is provided at greater that &gt;80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-NNEKLPTLKNVQDCL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-NNEKLPTLKNVQDCL-OH at the technical inquiry form on this page</p>

<p>17 beta estradiol antibody was raised in mouse using estradiol-6-CMO-BSA as the immunogen.</p>

<p>Peptide H-DGLDAASYYAPVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>This peptide hormone is a member of the lipid-binding proteins. It is a basic protein that has been found to be expressed in human leukemia cells and may have an important function in cellular transformation. The hl-60 cells, treated with this agent, show changes in cell shape and motility. Epidermal growth factor (EGF) receptors are activated by this fatty acid, which leads to an increase in the production of EGF by the cells. This peptide hormone has been shown to bind to the epidermal growth factor receptor and stimulate the production of EGF. Monoclonal antibodies can be used to identify this peptide hormone. The binding sites for this peptide hormone are dinucleotide phosphate or cytosolic proteins. This peptide hormone has been associated with autoimmune diseases such as rheumatoid arthritis and psoriatic arthritis.</p>

<p>Clopidogrel is a potent inhibitor of the platelet aggregation. It reduces blood clotting by inhibiting the ADP receptor on the surface of platelets, thereby inhibiting the aggregation and adhesion of platelets. Clopidogrel has been shown to be effective in preventing thrombosis, myocardial infarction (heart attack), and stroke. Clopidogrel inhibits the activity of cytochrome P450 3A4 (CYP3A4) and p2Y 12 receptors. Clopidogrel has been shown to have synergic effects with nonsteroidal anti-inflammatory drugs (NSAIDs). The polymorphic nature of Clopidogrel can be monitored using a liquid chromatography-tandem mass spectrometry (LC-MS/MS) method for quantification in biological samples such as human serum and plasma.</p>

<p>Peptide H-LNILNNK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Fmoc-D-Asp(OtBu)-OH is a cell biology research tool that can be used to study protein interactions and ion channels. It also has been used as an inhibitor for the activation of receptor tyrosine kinases, including human epidermal growth factor receptor 2 (HER2) in breast cancer cells. Fmoc-D-Asp(OtBu)-OH is a high purity compound that is available with CAS No. 112883-39-3.</p>

<p>Peptide H-ALEQDLPVNIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Tris is a buffering agent with an optimal pH range of 7.1-9.1 and a pKa of 8.07. It is used to prepare buffer solutions within physiological pH range and is suitable for western blot and nucleic acid electrophoresis. This buffer also forms metal chelates.</p>

<p>H-IAVAGELFQLER-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-IAVAGELFQLER-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-IAVAGELFQLER-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-IAVAGELFQLER-OH at the technical inquiry form on this page</p>

<p>H-TEHQAVLAEQK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TEHQAVLAEQK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TEHQAVLAEQK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TEHQAVLAEQK-OH at the technical inquiry form on this page</p>