Compuestos y reactivos bioquímicos

<p>Salmonella antibody (LPS core) was raised in mouse using LPS core of Salmonella as the immunogen.</p>

<p>Peptide H-DIQMTQSPSSLSASVGDRVTITCR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-HMTEVVR^HC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Conjugated Benzoylecgonine-BSA hapten</p>

<p>Peptide H-SP^YQLVLQHSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>GPX4 antibody was raised using a synthetic peptide corresponding to a region with amino acids QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAA</p>

<p>Mouse monoclonal CSPS antibody</p>

<p>The Influenza B antibody is a neutralizing antibody that is activated upon binding to the influenza virus. It specifically targets the glutamate region on the virus surface, preventing its attachment to host cells and subsequent infection. The antibody is immobilized on a cellulose matrix, which allows for easy purification and handling. Additionally, it has been conjugated with phalloidin, a cytotoxic compound that enhances its efficacy against the virus. This antibody has been extensively tested in human serum and has shown high specificity and affinity for the influenza B virus. It is widely used in Life Sciences research for studying viral replication, as well as in diagnostic assays for detecting influenza infections. The monoclonal antibodies are produced using advanced techniques and are of high purity and quality. Each batch undergoes rigorous quality control tests to ensure consistent performance. The electrode used for immobilization is made of high-quality materials to ensure stability and reliability. Furthermore, the antibody has low affinity for serum albumin, minimizing non-specific binding and</p>

<p>Turkey Red Blood Cells are biospecimens that can be used for various research purposes. They are commonly used in neutralizing assays, interferon assays, and monoclonal antibody binding studies. These blood cells contain globulin and other binding proteins, making them useful for studying the interaction between antibodies and antigens. Turkey Red Blood Cells have also been used in veterinary applications, such as testing the efficacy of anti-CD20 antibodies in animals. Additionally, they can be employed in liver microsome studies to assess drug metabolism and evaluate the effects of growth factors or excipients. Overall, Turkey Red Blood Cells are valuable tools for researchers investigating immune responses, antibody-drug interactions, and various other areas of study.</p>

<p>Peptide Ac-DLIEEAASRIVDAVIEQVKAAGAY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-TEWLDGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Dengue NS1 antibody is a monoclonal antibody that specifically targets the NS1 protein of the dengue virus. This antibody has been shown to have anti-angiogenesis properties, inhibiting the formation of new blood vessels. Additionally, it acts as a phosphatase inhibitor, preventing the dephosphorylation of proteins involved in cellular signaling pathways. The cysteine-rich nature of this antibody allows it to bind tightly to its target antigen, enhancing its effectiveness. In human serum, this antibody has been found to be reactive against dengue NS1 protein, making it a potential medicament for the treatment of dengue virus infection. Furthermore, studies have shown that this monoclonal antibody can neutralize TNF-α and other growth factors, reducing inflammation and promoting tissue repair. Its antigen binding molecules also have chemokine-like properties, facilitating immune cell recruitment to infected tissues. Lastly, this antibody has demonstrated cytotoxic effects on cells expressing high levels of deng</p>

<p>Peptide H-VAQELEEK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The Ebola virus VP40 protein is a recombinant protein used in the field of Life Sciences. It is commonly used in research and diagnostic applications. The protein is known for its ability to interact with collagen, which makes it a valuable tool in studying collagen-related diseases and disorders. Additionally, the Ebola virus VP40 protein has been found to have colloidal properties, making it useful in various experimental techniques such as electrode coatings and colloidal stabilization. Furthermore, this protein has been linked to helicobacter infections and has shown potential as a target for therapeutic interventions. Its interaction with nephrotoxic substances and alpha-fetoprotein has also been studied extensively. Monoclonal antibodies targeting the Ebola virus VP40 protein have been developed for research purposes, along with chemokines and growth factors that are involved in its signaling pathways. Overall, the Ebola virus VP40 protein plays a crucial role in understanding the mechanisms of viral infection and developing effective treatments against Ebola.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Cystatin C protein is a neutralizing protein that plays a crucial role in various biological processes. It is involved in the regulation of ornithine metabolism, glucose-6-phosphate production, and the activation of p53 protein. This protein is essential for the growth and development of cells, as it interacts with growth factors such as epidermal growth factor and histidine. Cystatin C also has binding properties with sclerostin, alpha-fetoprotein, and collagen, contributing to their stability and functionality. With its diverse functions and interactions, Cystatin C protein proves to be an integral component in Life Sciences research and applications.</p>

<p>The Plasmodium vivax antibody is a highly specialized product that consists of polymers designed to target and neutralize the antigen produced by the Plasmodium vivax parasite. This monoclonal antibody is specifically developed to bind to the surface proteins of the parasite, preventing its ability to invade human red blood cells and causing malaria.</p>

<p>Peptide H-FPDENFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>HCG antibody is a monoclonal antibody that specifically targets human chorionic gonadotropin (HCG). It has been widely used in life sciences research to study various aspects of HCG function. This antibody can neutralize the activity of HCG by binding to it and preventing its interaction with its receptors. Additionally, it has been shown to inhibit the growth of endothelial cells and adipocytes, suggesting potential therapeutic applications in conditions such as obesity and angiogenesis-related disorders. Furthermore, HCG antibody can be used as a diagnostic tool for detecting the presence of HCG in clinical samples, making it valuable in pregnancy testing and monitoring certain types of cancer. Its specificity and high affinity make it an essential tool for researchers and clinicians working in the field of reproductive biology and endocrinology.</p>

<p>Peptide Ac-GRGDSP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Nitrogen mustard derivative; DNA crosslinking agent; anti-cancer agent</p>

<p>Peptide Ac-VALDPIDISIVLNKIKSDLEESKEWIRRSNKILDSI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Chlamydia trachomatis antibody was raised in mouse using Chlamydia LGV2 as the immunogen.</p>

<p>H-WNSSWSNKSLDKIWN-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-WNSSWSNKSLDKIWN-OH is provided at greater that &gt;80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-WNSSWSNKSLDKIWN-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-WNSSWSNKSLDKIWN-OH at the technical inquiry form on this page</p>

<p>Peptide H-YGLVTYATYPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SSGLVSNAPGVQIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Ac-CRVTHPHLPRALMRS-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CRVTHPHLPRALMRS-NH2 is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CRVTHPHLPRALMRS-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CRVTHPHLPRALMRS-NH2 at the technical inquiry form on this page</p>

<p>Peptide LCBiot-PSKPSKRSFIEDLLFNKV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-YLPNPALQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LSARLAF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Purified native Human Urokinase protein (Low MW)</p>

<p>Activator of RET signalling cascade and a derivative of a GFL mimetic compound BT 13. Molecular docking calculations and molecular dynamics simulations were performed in GDNF−GFRα1−RetA complex and showed that BT 18 binds to the allosteric site in GFRα1 as well as RetA surface interfacing GFRα1.</p>

<p>H-LPPYIFT-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LPPYIFT-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LPPYIFT-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LPPYIFT-OH at the technical inquiry form on this page</p>

<p>Vimentin antibody was raised in mouse using Vimentin from cytoskeletal fraction of XLKE cells as the immunogen.</p>

<p>TSH antibody was raised in mouse using human TSH beta as the immunogen.</p>

<p>NBD 18:0 ceramide is a synthetic fluorescent lipid analogue, which is derived from the naturally occurring sphingolipid, ceramide. This product is characterized by the attachment of a nitrobenzoxadiazole (NBD) fluorophore to the ceramide backbone, allowing it to serve as a tool for visualizing and studying lipid dynamics within biological membranes.</p>

<p>The CYFRA 21-1 antigen is a native protein and antigen that plays a crucial role in the epidermal growth factor pathway. It can be used in various life science applications, such as research and diagnostic assays. The CYFRA 21-1 antigen is immobilized on an electrode surface using streptavidin, allowing for specific binding to its corresponding monoclonal antibodies. This interaction activates cytotoxic pathways, leading to the detection of the antigen. Additionally, the CYFRA 21-1 antigen can be used in conjunction with other proteins and antigens, such as insulin or alpha-fetoprotein, to create multiplex assays for comprehensive analysis. With its high specificity and sensitivity, the CYFRA 21-1 antigen offers valuable insights into cellular processes and can aid in disease diagnosis and monitoring.</p>

<p>H-AAWTSSGPA-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-AAWTSSGPA-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-AAWTSSGPA-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-AAWTSSGPA-OH at the technical inquiry form on this page</p>

<p>Peptide H-VFTPLEVDVAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>PGP 9.5 antibody was raised in guinea pig using the peptide GASSEDTLLKDAAKVCR, corresponding to residues 175-191 of soluble cytoplasmic protein human PGP 9.5 as the immunogen.</p>

<p>Purified recombinant REN protein (His tag)</p>

<p>CFP10 protein is a key component of the ESAT-6/CFP-10 complex, which is secreted by Mycobacterium tuberculosis. This complex plays a crucial role in the pathogenesis of tuberculosis by inducing a strong immune response. CFP10 protein has been extensively studied for its potential as a diagnostic marker for tuberculosis and as a vaccine candidate. It has also been used in research to study the interaction between Mycobacterium tuberculosis and host cells. The recombinant CFP10 protein is available for use in various life sciences applications, including the development of monoclonal antibodies and assays to detect IFN-gamma production. Its high purity and quality make it an ideal choice for researchers working in the field of tuberculosis and related diseases.</p>

<p>FABP free normal human serum</p>

<p>SAE1 antibody was raised in mouse using recombinant Human Sumo1 Activating Enzyme Subunit 1 (Sae1)</p>

<p>Progesterone antibody was raised in mouse using progesterone-11-BSA as the immunogen.</p>

<p>Normal Rabbit Serum is a versatile product that contains a variety of growth factors, chemokines, and antibodies. It is commonly used in life sciences research, veterinary applications, and other fields.</p>

<p>Peptide H-VLLPEYGGTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Mouse monoclonal Thyroxine antibody</p>

<p>Peptide H-QETVDCLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>HAMA blocking reagent is a highly effective product used in Life Sciences research. It is designed to neutralize the cytotoxic effects of monoclonal antibodies, such as TNF-α and epidermal growth factor (EGF), allowing for accurate and reliable experimental results. This reagent acts as a blocker, preventing the binding of these antibodies to their target receptors and thus inhibiting their activity. HAMA blocking reagent can be used in various applications, including lysis, dilution, and assay procedures. It is compatible with a wide range of buffers and can be easily integrated into existing experimental protocols. Whether you are working with teriparatide or phycocyanin, this versatile product ensures optimal performance and reproducibility in your research.</p>