Compuestos y reactivos bioquímicos
Los bioquímicos y reactivos son sustancias fundamentales para la investigación y el desarrollo en campos como la biotecnología, la biología molecular, la farmacología y la medicina. Estos productos son esenciales para una variedad de aplicaciones, incluyendo la síntesis de compuestos, el análisis de muestras biológicas, la investigación de procesos metabólicos y la producción de medicamentos. En CymitQuimica, ofrecemos una amplia selección de bioquímicos y reactivos de alta calidad y pureza, adecuados para diversas necesidades científicas e industriales. Nuestro catálogo incluye enzimas, anticuerpos, ácidos nucleicos, aminoácidos, y muchos otros productos, todos diseñados para apoyar a los investigadores y profesionales en sus proyectos de investigación y desarrollo, asegurando resultados confiables y reproducibles.
Subcategorías de "Compuestos y reactivos bioquímicos"
- Biomoléculas(99.115 productos)
- Por objetivo biológico(99.074 productos)
- Según efectos farmacológicos(6.785 productos)
- Crioconservantes(21 productos)
- Desinfectantes y compuestos relacionados(28 productos)
- Hormonas(346 productos)
- Biología Vegetal(6.693 productos)
- Metabolitos secundarios(14.219 productos)
Se han encontrado 130577 productos de "Compuestos y reactivos bioquímicos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-YAAELHLVHWNTK^-OH
<p>Peptide H-YAAELHLVHWNTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Z-GLF-CMK
<p>Peptide Z-GLF-CMK is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>740 Y-P
<p>Cell permeable peptide which is able to activate phosphoinositide 3- kinase, for which it binds with high affinity to the p85 subunit. 740 Y-P also has mitogenic activity as it is able to induce mitosis in muscle cells, and promotes cell survival in neurones. PI 3- kinase's are a family of enzymes involved in many cellular pathways including cell proliferation, growth, differentiation, survival, motility, and intracellular trafficking. PI 3 Kinases are therefore also involved in many cancers.</p>Pureza:Min. 95%Forma y color:PowderPeso molecular:3,268.6 g/molH-V^YIHPF-OH
<p>Peptide H-V^YIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Arformoterol tartrate - Bio-X ™
CAS:Producto controlado<p>This product is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.</p>Fórmula:C19H24N2O4•C4H6O6Pureza:Min. 95%Forma y color:PowderPeso molecular:494.49 g/molH-NLVPMVATV-NH2
<p>Peptide H-NLVPMVATV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Factor H
<p>Factor H is a glycoprotein that plays a crucial role in the regulation of the complement system. It acts as an inhibitor of the alternative pathway, preventing excessive activation and subsequent damage to host cells. Factor H contains multiple domains, including a p38 mitogen-activated protein (MAP) kinase binding site and disulfide bonds that contribute to its stability. This protein is essential for maintaining immune homeostasis and preventing autoimmune diseases. Additionally, Factor H has been studied for its potential therapeutic applications in various fields, such as erythropoietin production, collagen synthesis, and multidrug resistance inhibition. Its unique properties make it a valuable tool for researchers in the life sciences field.</p>Pureza:>98% (By Sds - Page)H-LTVEDPVTVEYITR^-OH
<p>Peptide H-LTVEDPVTVEYITR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GPGGVWAAK^-OH
<p>Peptide H-GPGGVWAAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ATFQTPDFIVPLTDLR^-OH
<p>Peptide H-ATFQTPDFIVPLTDLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SARS-CoV-2 Nucleocapsid (376-385)
<p>SARS-CoV-2 is an enveloped single-stranded, positive-sense RNA virus. The SARS-CoV-2 nucleocapsid (N) protein is essential for viral RNA replication and new virion assembly. The N protein assembles the positive strand viral genome RNA forming a helical ribonucleocapsid (RNP) during the packaging of the RNA genome. The N protein is also involved in regulating viral RNA synthesis during replication and RNA transcription and modulating metabolism in infected subjects.</p>Pureza:Min. 95%Peso molecular:1,127.6 g/molInfluenza HA (518-526)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Fórmula:C42H69N9O15Peso molecular:940.07 g/molH-L^GGDL^GTYVINK^-OH
<p>Peptide H-L^GGDL^GTYVINK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-LQPELDSFKEELDKY-OH
<p>Peptide LCBiot-LQPELDSFKEELDKY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IQILEGWK^-OH
<p>Peptide H-IQILEGWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>EBV BNRF1 (1238-1252)
<p>Cellular immunotherapy is an effective treatment option against Epstein-Barr virus (EBV)-driven lymphoproliferation in recipients of hematopoietic stem cells. However, increasing the number of identified epitope targets will help improve the response rate and success. Viral tegument protein BNRF1 is a critical target in EBV inducing specific CD4+ T-cell responses. 18 epitopes within BNRF1 are known, including (1238-1252). BNRF1-specific CD4+ T cells are cytotoxic and limit EBV-driven B cell transformation. Work with EBV BNRF1 (1238-1252) epitope and others will help improve T cell immunotherapy and our understanding of host-virus interaction.</p>Peso molecular:1,838.9 g/molSynapsin-1 (115-128) Heavy
<p>Peptide derived from the phosphoprotein synapsin-1, a substrate in the presynaptic terminal for protein kinases such as cyclic AMP-dependent protein kinases and calcium dependent protein kinases. The lysine at position 14 is isotopically labelled with carbon-13 (6) and nitrogen-15 (2).</p>Pureza:Min. 95%Peso molecular:1,642.9 g/molCMVpp65 - 8 (RGDTPVLPHETRLLQ)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecular:1,732 g/molAc-CAEAETAKDN-OH
<p>Peptide Ac-CAEAETAKDN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GEGIEEFLR^-OH
<p>Peptide H-GEGIEEFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PGP-NH2
<p>Peptide H-PGP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QVSSHIQVLAR^-OH
<p>Peptide H-QVSSHIQVLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Pureza:Min. 95%H-ELVVDFLSYK^-OH
<p>Peptide H-ELVVDFLSYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>TREM2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TREM2 antibody, catalog no. 70R-4485</p>Pureza:Min. 95%H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
<p>Exendin-4 is a 39-amino acid peptide incretin mimetic. Exendin-4, also known as Exenatide, was originally isolated from the venom of Gila monster lizard called Heloderma suspectum1. Exendin-4 is a long-acting analog of the mammalian intestinal hormone glucagon-like peptide I (GLP-1) and therefore exhibits glucoregulatory activities to control plasma glucose levels2. Exendin-4 enhances insulin synthesis and secretion in a glucose-dependent manner, while downregulating inappropriately high glucagon release, slowing gastric emptying and decreasing appetite2. The increase in maximum insulin secretion is due to a greater increase in cAMP production in pancreatic β cells3. Exendin-4 is a potent agonist of the Glucagon-Like Peptide-1 Receptor (GLP-1R ; Kd = 136pM).</p>H-GGIVDEGALLR^-OH
<p>Peptide H-GGIVDEGALLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LYPFTWDAVR^-OH
<p>Peptide H-LYPFTWDAVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GEGTFTSDLSK^-OH
<p>Peptide H-GEGTFTSDLSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-DHLASLWWGTEL-NH2
<p>Peptide Ac-DHLASLWWGTEL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Aclidinium bromide
CAS:<p>Muscarinic antagonist; bronchodilator</p>Fórmula:C26H30NO4S2·BrPureza:Min. 95 Area-%Forma y color:Purple PowderPeso molecular:564.56 g/molH-SFSLSTNLQESLR^-OH
<p>Peptide H-SFSLSTNLQESLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VQIVYKPVDLSK^-OH
<p>Peptide H-VQIVYKPVDLSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LVEAFGGATK^-OH
<p>Peptide H-LVEAFGGATK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GQNDTSQTSSPS-Phosphocolamine
<p>Peptide H-GQNDTSQTSSPS-Phosphocolamine is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Tachyplesin1-amide
<p>Peptide Tachyplesin1-amide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Fórmula:C99H151N35O19S4Peso molecular:2,263.76 g/molH-IQASFR^-OH
<p>Peptide H-IQASFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>AF488 Plectin-1-targeting peptide
<p>Plectin is a large protein found in nearly all mammalian cells and it acts as a link between the three main components of the cytoskeleton: actin microfilaments- microtubules and intermediate filaments. Plectin also links the cytoskeleton to junctions found in the plasma membrane that structurally connect different cells. Therefore plectin plays an important role in maintaining the mechanical integrity and viscoelastic properties of tissues.In cardiac muscle and skeletal muscle, plectin is localised to specialised entities known as Z-discs. Plectin binds several proteins including: vinculin, DES, actin, fodrin, microtubule-associating proteins, nuclear laminin B, SPTAN1, vimentin and ITGB4. Mutations in PLEC have been associated with epidermolysis bullosa simplex with muscular dystrophy. Plectin has been proposed as a biomarker for pancreatic cancer. Alexa Fluor 488 dye is a bright, green-fluorescent dye with excitation maxima around 490 and emission maxima around 525. Alexa Fluor 488 dye is pH-insensitive over a wide molar range.</p>Pureza:Min. 95%Forma y color:PowderPeso molecular:1,857.7 g/molH-HVGDLGNVTADK^-OH
<p>Peptide H-HVGDLGNVTADK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>MYH9 741-749 (HLA-A*02:01)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>(Arg8) Vasotocin
<p>(Arg8) Vasotocin (AVT) is a member of the neurohypophyseal hormone family which contains 9 amino acids with the cysteines at positions 1 and 6 linked through a disulphide bridge. Within the central nervous system of lower vertebrates, AVT has been shown to play a role as a neuromodulator and controls reproductive behaviour. Furthermore it regulates osmotic and electrolyte balance and blood pressure within the periphery. In the mammalian brain AVT functions through arginine vasopressin (AVP) or oxytocin receptor cross-reactions. Mice have an AVT reactive receptor specific to AVT and neuropeptide S. This AVT which functions to regulate processes such as sleep and reproduction.</p>Forma y color:PowderPeso molecular:1,049.5 g/molTyrosinase antibody
<p>The Tyrosinase antibody is a monoclonal antibody that targets the tyrosinase enzyme involved in melanogenesis. This antibody specifically binds to tyrosinase, inhibiting its activity and preventing the production of melanin. It has been widely used in the field of life sciences for research purposes, as well as in the development of potential therapeutic agents for conditions related to abnormal melanin production. The Tyrosinase antibody has also been shown to have neutralizing effects on growth factors and β-catenin signaling pathways, making it a versatile tool for studying various cellular processes. Whether you're working on understanding melanogenesis or developing a new medicament, this high-quality monoclonal antibody is an essential component of your research toolkit.</p>[5-FAM]-(RFR)4XB
<p>(RXR)4XB is a cationic membrane-penetrating peptide and is effective in delivering phosphorodiamidate morpholino oligonucleotides (PMOs) into eukaryotic cells such as Escherichia coli. It contains 5-carboxyfluorescein (5-FAM), a widely used green fluorescent tag.</p>Peso molecular:2,396.3 g/molMART-1 26-35 (HLA-B*35:01)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-FATVVEELFR^-OH
<p>Peptide H-FATVVEELFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>L57
<p>The blood-brain barrier (BBB) is a major obstacle to drug delivery into the central nervous system (CNS), in particular for macromolecules such as peptides and proteins. However, certain macromolecules can reach the CNS via a receptor-mediated transcytosis (RMT) pathway, and low-density lipoprotein receptor-related protein 1 (LRP1) is one of the promising receptors for RMT. L57 can therefore be used for the development of RMT-based drugs for the treatment of CNS diseases.</p>Forma y color:PowderPeso molecular:2,842.3 g/molSEQ ID NO:549
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Fórmula:C63H91N13O13Peso molecular:1,238.51 g/molRFRP-1 (Human)
CAS:<p>Neuropeptide:<br>Neuropeptides are small signaling molecules produced and released by neurons engaged in many physiological functions. Indeed, neuropeptides act on neural substrates such as G protein-coupled receptors (GPCRs), tyrosine-kinase receptor, insuline-like peptides and also ion channels. Actions of neuropeptides result in slow-onset, long-lasting modulation of synaptic transmission.<br>Pro-FMRFamide-related neuropeptide VF:<br>Pro-FMRFamide-related neuropeptide VF also called neuropeptide VF precursor are expressed in neurons in mediobasal hypothalamus. Neuropeptide VF precursor is a propeptide which is cleaved in three others peptide: Neuropeptide RFRP-1, RFRP-2 and RFRP-3.<br>Neuropeptide RFRP-1 (81-92):<br>Neuropeptide RFRP-1 play a role in the negative regulation of gonadotropin synthesis and secretion. Neuropeptide RFRP-1 is an agonist of the NPFF1 and NPFF2 receptors. In rats, Neuropeptide RFRP-1 increases prolactin release. Neuropeptide RFRP-1 (81-92) MPHSFANLPLRF-NH2 is a part of Neuropeptide RFRP-1 and is used to study NPFF receptors.</p>Fórmula:C67H101N19O14SPeso molecular:1,428.73 g/molH-MKLSEKNSAETKESC-NH2 PAB-405-1337F
<p>Peptide H-MKLSEKNSAETKESC-NH2 PAB-405-1337F is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
