Compuestos y reactivos bioquímicos
Los bioquímicos y reactivos son sustancias fundamentales para la investigación y el desarrollo en campos como la biotecnología, la biología molecular, la farmacología y la medicina. Estos productos son esenciales para una variedad de aplicaciones, incluyendo la síntesis de compuestos, el análisis de muestras biológicas, la investigación de procesos metabólicos y la producción de medicamentos. En CymitQuimica, ofrecemos una amplia selección de bioquímicos y reactivos de alta calidad y pureza, adecuados para diversas necesidades científicas e industriales. Nuestro catálogo incluye enzimas, anticuerpos, ácidos nucleicos, aminoácidos, y muchos otros productos, todos diseñados para apoyar a los investigadores y profesionales en sus proyectos de investigación y desarrollo, asegurando resultados confiables y reproducibles.
Subcategorías de "Compuestos y reactivos bioquímicos"
- Biomoléculas(99.127 productos)
- Por objetivo biológico(99.160 productos)
- Según efectos farmacológicos(6.787 productos)
- Crioconservantes(21 productos)
- Desinfectantes y compuestos relacionados(28 productos)
- Hormonas(346 productos)
- Biología Vegetal(6.742 productos)
- Metabolitos secundarios(14.222 productos)
Se han encontrado 130581 productos de "Compuestos y reactivos bioquímicos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-FL^SLDYIPQR-OH
<p>Peptide H-FL^SLDYIPQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>ApoA-I antibody
<p>ApoA-I antibody was raised in goat using highly purified human Apo A-I. as the immunogen.</p>Pureza:Min. 95%H-EEISGV^K-OH
<p>Peptide H-EEISGV^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HSFKWLDSPRLR-NH2
<p>Peptide H-HSFKWLDSPRLR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CGGVSAYLSRPSPFD-OH
<p>H-CGGVSAYLSRPSPFD-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CGGVSAYLSRPSPFD-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CGGVSAYLSRPSPFD-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CGGVSAYLSRPSPFD-OH at the technical inquiry form on this page</p>Pureza:Min. 95%Ac-TEAAGAM-NH2
<p>Ac-TEAAGAM-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-TEAAGAM-NH2 is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-TEAAGAM-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-TEAAGAM-NH2 at the technical inquiry form on this page</p>Pureza:Min. 95%Ziprasidone - Bio-X ™
CAS:Producto controlado<p>Ziprasidone is an atypical antipsychotic drug that is used to manage schizophrenia, bipolar mania, and agitation. This drug binds to serotonin and dopamine receptors. As a result it enhances modulation of mood and improves overall cognition.</p>Fórmula:C21H21ClN4OSPureza:Min. 95%Forma y color:PowderPeso molecular:412.94 g/molCMV Pp65 protein
<p>The E.Coli derived 52.2 kDa recombinant protein contains the CMV Pp65 (UL83) immunodominant regions, 297-510 amino acids. Recombinant CMV-Pp65 is fused to a 26 kDa GST tag.</p>Pureza:Min. 95%H-HMTEVVR^HC-OH
<p>Peptide H-HMTEVVR^HC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DIQMTQSPSSLSASVGDRVTITCR-NH2
<p>Peptide H-DIQMTQSPSSLSASVGDRVTITCR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 100 (DDVWTSGSDSDEELV)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecular:1,653.6 g/molH-VTSIQD^WV^Q^K^-OH
<p>Peptide H-VTSIQD^WV^Q^K^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YVPPSSTDR^-OH
<p>Peptide H-YVPPSSTDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>ESAT6 protein (His tag)
<p>Purified recombinant Mycobacterium tuberculosis ESAT6 Protein (His tag)</p>Ac-CLRIQDPYRRTHLRNR-NH2
<p>Ac-CLRIQDPYRRTHLRNR-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CLRIQDPYRRTHLRNR-NH2 is provided at greater that >85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CLRIQDPYRRTHLRNR-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CLRIQDPYRRTHLRNR-NH2 at the technical inquiry form on this page</p>Pureza:Min. 95%H-DRV^YI^HPFHL-OH
<p>Peptide H-DRV^YI^HPFHL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>α Synuclein protein
<p>MDVFMKGLSK AKEGVVAAAE KTKQGVAEAA GKTKEGVLYV GSKTKEGVVH GVATVAEKTK EQVTNVGGAV VTGVTAVAQK TVEGAGSIAA ATGFVKKDQL GKNEEGAPQE GILEDMPVDP DNEAYEMPSE EGYQDYEPEA</p>Pureza:>95% By Sds-PageSIVmac239 - 72
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecular:1,736.9 g/molH-DTDILAAFR^-OH
<p>Peptide H-DTDILAAFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Osteocalcin antibody
<p>The Osteocalcin antibody is a highly specialized monoclonal antibody that targets and neutralizes the activity of osteocalcin. Osteocalcin is a protein involved in bone formation and remodeling. This antibody specifically binds to osteocalcin, preventing its activation and inhibiting its function.</p>Perilipin antibody
<p>Perilipin antibody was raised using the N terminal of PLIN corresponding to a region with amino acids STQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTISTRLRSARNS</p>H-FAIQDISVEETSAK^-OH
<p>Peptide H-FAIQDISVEETSAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Goat anti Mouse IgG (H + L)
<p>Goat anti Mouse IgG was raised in goat using affinity pure mouse IgG (H + L) as the immunogen.</p>Pureza:Min. 95%H-AIWNVINWENVSQR^-OH
<p>Peptide H-AIWNVINWENVSQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SART3 309-317 (HLA-A*02:01)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Salmonella antibody (LPS core)
<p>Salmonella antibody (LPS core) was raised in mouse using LPS core of Salmonella as the immunogen.</p>Angiotensin I/II (3-7)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Fórmula:C31H45N7O7Peso molecular:627.75 g/molH-DHIGTR^-OH
<p>Peptide H-DHIGTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IILEGTER^-OH
<p>Peptide H-IILEGTER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-GKG-OH
<p>Peptide Ac-GKG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Acid brown 97
CAS:<p>Acid brown 97 is a reaction product of peroxy-chloro-nitroso-cycloaliphatic compounds. It is used as an oxidizing agent in the production of chlorine and as a bleaching agent in the textile industry to remove stains from cotton, linen, and other fibres. When acid brown 97 comes into contact with wastewater, it reacts with the water to form hydrochloric acid and nitric acid. Acid Brown 97 has been shown to have an absorbance value at 420 nm of 0.2.</p>Pureza:Min. 95%H-APLILSR^-OH
<p>Peptide H-APLILSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PRKFFNRTCKCTGNF-OH
<p>H-PRKFFNRTCKCTGNF-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-PRKFFNRTCKCTGNF-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-PRKFFNRTCKCTGNF-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-PRKFFNRTCKCTGNF-OH at the technical inquiry form on this page</p>Pureza:Min. 95%H-KAVYNFATM-OMe
<p>Peptide H-KAVYNFATM-OMe is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-LRLRGG-CHO
<p>Peptide Ac-LRLRGG-CHO is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SIVmac239 - 4
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecular:1,767.1 g/molPNU 120596
CAS:<p>A type-II positive allosteric modulator of α7 neuronal nicotinic acetylcholine receptors with IC50 values of 216 nM. Increases calcium flux in response to agonists, by lengthening the channel’s mean open time. Ex vivo and in vivo models of ischemic stroke demonstrate the conversion of endogenous choline or acetylcholine into neuroprotective agents by PNU 120596.</p>Fórmula:C13H14ClN3O4Pureza:Min. 95%Forma y color:PowderPeso molecular:311.72 g/molThyroid Peroxidase protein
<p>Thyroid Peroxidase protein is a glycoprotein that plays a crucial role in the production of thyroid hormones. It is an important target for antibodies and has been extensively studied for its involvement in autoimmune thyroid diseases. Thyroid Peroxidase protein is commonly used as an antigen to develop monoclonal antibodies for diagnostic purposes. These antibodies have anti-angiogenesis properties, making them valuable tools in cancer research. The colloidal streptavidin electrode-based assay is commonly used to detect and quantify Thyroid Peroxidase protein levels in various biological samples, including human serum. This native protein exhibits activated fatty acid binding capacity, further highlighting its significance in life sciences research.</p>Pureza:Min. 95%K252c
CAS:<p>Inhibitor of protein kinase PKC</p>Fórmula:C20H13N3OPureza:Min. 95%Forma y color:PowderPeso molecular:311.34 g/molH-NEQEQPLGQWHL^S-OH
<p>Peptide H-NEQEQPLGQWHL^S-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Tachyplesin III
<p>Tachyplesin is a type of cationic β-hairpin antimicrobial peptide (AMP) discovered from horseshoe crab hemocytes. This product has disulfide bonds between Cys3-Cys16, Cys7-Cys12 and is available as a trifluoroacetate salt.<br>One letter code: H-KWCFRVCYRGICYRKCR-NH2</p>Fórmula:C99H151N33O19S4Pureza:Min. 95%Peso molecular:2,235.77 g/molBBC3 amide
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-SLYASSPGGVYATR^-OH
<p>Peptide H-SLYASSPGGVYATR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 90 (LQRGPQYSEHPTFTS)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecular:1,747.9 g/molH-RPHFPQFSYSASGTA^-OH
<p>Peptide H-RPHFPQFSYSASGTA^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Corazonin
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Fórmula:C61H78N16O18Peso molecular:1,323.3 g/molH-AQGFTEDTIVFLPQTDK^-OH
<p>Peptide H-AQGFTEDTIVFLPQTDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Dynorphin A (1-12), porcine
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Fórmula:C69H114N22O14Peso molecular:1,475.82 g/molTreponema pallidum antibody (FITC)
<p>Treponema pallidum antibody (FITC) was raised in rabbit using highly purified Treponema pallidum as the immunogen.</p>
