Compuestos y reactivos bioquímicos

<p>This product is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&amp;D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.</p>

<p>H-DSLEMTEENLADQFKDF-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-DSLEMTEENLADQFKDF-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-DSLEMTEENLADQFKDF-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-DSLEMTEENLADQFKDF-OH at the technical inquiry form on this page</p>

<p>Peptide Ac-VTLQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>ARQ 087 is a monoclonal antibody that targets the epidermal growth factor receptor (EGFR) on cancer cells. The EGFR plays an important role in cell proliferation. ARQ 087 blocks the binding of EGF to EGFR, inhibiting the proliferation of cancer cells and leading to tumour shrinkage. ARQ 087 has been shown to have therapeutic effects on animal models of skin cancer and solid tumours. This drug is also able to inhibit the growth of Caco2 cells, a type of human colon carcinoma cell line, as well as basic fibroblast cells from healthy individuals.</p>

<p>Ac-PAINVAVHVFRKC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-PAINVAVHVFRKC-NH2 is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-PAINVAVHVFRKC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-PAINVAVHVFRKC-NH2 at the technical inquiry form on this page</p>

<p>Sheep anti bovine IgA was raised in sheep using bovine IgA as the immunogen.</p>

<p>Peptide H-SGRGKGGKGLGKGGAKRHRKV-NTBiot is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ISVYYNEATGGK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>ATP6V1C1 antibody was raised using the N terminal of ATP6V1C1 corresponding to a region with amino acids MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNG</p>

<p>Peptide H-QVLQVTPFAER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-VTMAK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VTMAK-OH is provided at greater that &gt;98% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VTMAK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VTMAK-OH at the technical inquiry form on this page</p>

<p>Peptide H-TLNAWVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Ac-CEHVVRVNARVR-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CEHVVRVNARVR-NH2 is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CEHVVRVNARVR-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CEHVVRVNARVR-NH2 at the technical inquiry form on this page</p>

<p>Neu antibody was raised in mouse using RAC311 Cells transfected with SV40-neu construct, expressing human neu protein as the immunogen.</p>

<p>Peptide H-VEIFYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-NLWAAQRYGRELRRMSDEFVDSFKK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-PIIHFGSDYEDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>H-SVLLDAASGQLR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SVLLDAASGQLR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SVLLDAASGQLR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SVLLDAASGQLR-OH at the technical inquiry form on this page</p>

<p>Cu/Zn SOD antibody was raised in rabbit using native human Cu/Zn SOD-1. as the immunogen.</p>

<p>Inhibitor of cathepsins and other cysteine proteases</p>

<p>Gentamicin antibody was raised in goat using gentamicin-BSA as the immunogen.</p>

<p>The GCSF antibody is a monoclonal antibody that has various applications in the field of Life Sciences. It can be used in combination with other drugs such as irinotecan to enhance their cytotoxic effects. Additionally, the GCSF antibody can act as a DNA aptamer and specifically bind to its target, making it a valuable tool for research and diagnostic purposes. This monoclonal antibody has shown reactivity against several targets, including steroid receptors, sphingosine receptors, androgen receptors, interferon receptors, tyrosinase, and various inhibitors. Its versatility and specificity make it an essential component in many scientific studies and experiments.</p>

<p>Anti-5'-nucleotidase/CD73 antibody</p>

<p>Canine IgE antibody was raised in goat using canine IgE as the immunogen.</p>

<p>Peptide Ac-NRV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-AGAKWSWWELTWVGG-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-AGAKWSWWELTWVGG-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-AGAKWSWWELTWVGG-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-AGAKWSWWELTWVGG-OH at the technical inquiry form on this page</p>

<p>H-WDNFQGK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-WDNFQGK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-WDNFQGK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-WDNFQGK-OH at the technical inquiry form on this page</p>

<p>Peptide H-GFYAEGSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-HEIPVLPNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Phosphodiesterase PDE4 inhibitor</p>

<p>Peptide 5TAMRA-KKRYDREFLLGFQF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VVGADGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>H-KITTESIVIW-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-KITTESIVIW-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-KITTESIVIW-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-KITTESIVIW-OH at the technical inquiry form on this page</p>

<p>Flurbiprofen mannitol ester is a sugar derivative of flurbiprofen. The chemical name for this compound is 3-O-[2,4-dichloro-5-(1,1,2,3,3,3-hexafluoro-propoxy)phenyl]-D-galactopyranose. Flurbiprofen mannitol ester has the CAS number 59542-03-7 and the molecular formula C12H18Cl2FNO8. It has a molecular weight of 532.07 g/mol. Flurbiprofen mannitol ester is a white to off white powder that is soluble in water and sparingly soluble in alcohol. This product can be custom synthesized in an oligosaccharide or complex carbohydrate form that can be glycosylated or polysaccharided with click modification or methylation to provide high purity. Flurbiprofen man</p>

<p>Peptide H-DVNAAIAAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-WQEEMELYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Anti-TAS2R39 antibody</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Normal Council Serum is a high-quality serum that contains a range of antibodies, interferon, and glycoproteins. It is derived from liver microsomes and is rich in lysine, which plays a crucial role in protein synthesis. This serum has been extensively tested for its antiviral properties and has shown significant activity against a variety of viruses. Additionally, Normal Council Serum contains lectins that have been proven to enhance immune response and promote the production of chemokines. It is widely used in life sciences research and veterinary applications due to its potent immunological effects. This serum is carefully formulated with excipients to ensure stability and efficacy. With its broad range of applications, Normal Council Serum is an essential tool for any researcher or veterinarian seeking to understand and manipulate the immune system.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-THNVLER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Mouse monoclonal Zika virus envelope antibody</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Please enquire for more information about C.I.Reactive blue 225 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-ETIEDLPGK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ETIEDLPGK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ETIEDLPGK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ETIEDLPGK-OH at the technical inquiry form on this page</p>

<p>Peptide H-SLLQHLIGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-AIEDYINEFSVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-TEAFIPFSLGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>