
Compuestos relacionados con enzimas, péptidos y proteínas
Los compuestos relacionados con enzimas, péptidos y proteínas son críticos para estudiar y manipular las vías bioquímicas. Estos compuestos incluyen enzimas que catalizan reacciones bioquímicas, péptidos que actúan como hormonas y moléculas de señalización, y proteínas que desempeñan una amplia gama de funciones dentro de los organismos. Esta categoría abarca inhibidores, activadores, sustratos y otros reactivos esenciales para la enzimología, la proteómica y la investigación de péptidos. En CymitQuimica, ofrecemos una diversa selección de compuestos de alta calidad para facilitar su investigación en cinética enzimática, función de proteínas y síntesis de péptidos, asegurando resultados precisos y fiables.
Subcategorías de "Compuestos relacionados con enzimas, péptidos y proteínas"
- Aminoácidos (AA)(40.509 productos)
- Enzimas(3.559 productos)
- Péptidos(30.720 productos)
- Proteínas(15.023 productos)
Se han encontrado 1312 productos de "Compuestos relacionados con enzimas, péptidos y proteínas"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Orphan GPCR SP9155 Agonist P550 (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about Orphan GPCR SP9155 Agonist P550 (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C126H195N37O37Pureza:Min. 95%Peso molecular:2,820.12 g/molGRF (human) acetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Fórmula:C215H358N72O66SPureza:Min. 98 Area-%Forma y color:PowderPeso molecular:5,039.65 g/molPACAP-38 (human, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS:<p>PACAP-38 is a peptide that has been shown to have a variety of physiological effects, including the regulation of brain functions and immunological responses. PACAP-38 has been found to bind to toll-like receptor 4 (TLR4) in macrophages and neutrophils, which stimulates the production of proinflammatory cytokines. It also interacts with adenylate cyclase, which leads to an increase in cAMP levels. This may be the mechanism by which PACAP-38 regulates brain functions. The biological function of PACAP-38 is not yet clear but it may act as a signal peptide, regulating protein synthesis and gene expression.</p>Fórmula:C203H331N63O53SPureza:Min. 95%Peso molecular:4,534.26 g/mol(Hyp 474·477,Gln479)-cyclo-a-Fetoprotein (471-479) (human, lowland gorilla)
CAS:<p>Please enquire for more information about (Hyp 474·477,Gln479)-cyclo-a-Fetoprotein (471-479) (human, lowland gorilla) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C40H63N11O16SPureza:Min. 95%Peso molecular:986.06 g/mol(D-Pro194)-IL-1β (193-195) (human)
CAS:<p>IL-1beta is a pro-inflammatory cytokine that belongs to the group of interleukins. It is synthesized as a preproprotein which undergoes proteolytic processing to produce a mature 34 kDa protein with an N-terminal lys-pro sequence. IL-1beta has been shown to induce allergic reactions in animals and humans, constrictions in airways, and antigen presentation by antigen presenting cells, such as macrophages and dendritic cells. This cytokine also has costimulatory effects on immune responses and has been shown to be involved in autoimmune diseases and inflammatory diseases. The IL-1beta gene contains a hydroxyl group at the COOH terminus that allows for the formation of an aspirin binding site.</p>Fórmula:C15H28N4O5Pureza:Min. 95%Peso molecular:344.41 g/molAdrenomedullin (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Adrenomedullin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C242H381N77O75S5Pureza:Min. 95%Peso molecular:5,729.42 g/molPACAP-38 (31-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about PACAP-38 (31-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C47H83N17O11Pureza:Min. 95%Peso molecular:1,062.27 g/mol(Des-octanoyl)-Ghrelin (human) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Fórmula:C141H235N47O41Pureza:Min. 95%Peso molecular:3,244.67 g/mol(Tyr0)-Atriopeptin II (rat)
CAS:<p>Please enquire for more information about (Tyr0)-Atriopeptin II (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C107H165N35O34S2Pureza:Min. 95%Peso molecular:2,549.8 g/mol(Pyr 16)-VIP (16-28) (human, mouse, rat)
CAS:<p>Please enquire for more information about (Pyr 16)-VIP (16-28) (human, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C68H114N18O18SPureza:Min. 95%Peso molecular:1,503.81 g/molBiotinyl-Atrial Natriuretic Factor (1-28) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Atrial Natriuretic Factor (1-28) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C137H217N47O41S4Pureza:Min. 95%Peso molecular:3,306.75 g/molN,N'-Dimethyl-2,7-Diazapyrenium bistetrafluoroborate
CAS:<p>Please enquire for more information about N,N'-Dimethyl-2,7-Diazapyrenium bistetrafluoroborate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C16H14B2F8N2Pureza:Min. 95%Peso molecular:407.91 g/molNeuromedin S (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuromedin S (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C193H307N57O49SPureza:Min. 95%Peso molecular:4,241.92 g/molProkineticin 2 Isoform 2 (human) trifluoroacetate salt
CAS:<p>Prokineticin-2 is a protein that is encoded by the PROK2 gene. It has been shown to inhibit VEGF in vitro and to be anti-inflammatory. Prokineticin-2 binds to the receptor for colony stimulating factor 1 (CSF1) and promotes angiogenesis by inducing the production of angiogenic factors such as vascular endothelial growth factor (VEGF), erythropoietin, and granulocyte macrophage colony stimulating factor (GM-CSF). It also inhibits transcriptional regulation of genes involved in inflammation, including IL-10, which inhibits IL-12 production.</p>Fórmula:C379H606N114O101S13Pureza:Min. 95%Peso molecular:8,792.43 g/molBismuth citrate
CAS:<p>Bismuth citrate is an antimicrobial agent that is used to treat helicobacter pylori infections. Bismuth citrate may be an alternative to clarithromycin and metronidazole for the treatment of antibiotic-resistant strains of helicobacter. It has been shown to improve duodenal ulcer healing and reduce the incidence of gastric ulcers in a group of patients with duodenal ulcer disease. This drug has also been shown to significantly reduce the incidence of gastric cancer in patients with Helicobacter pylori infection. Bismuth citrate is a polymeric compound that is thought to bind to the bacterial cell wall and inhibit its growth through inhibition of protein synthesis, but this mechanism is not well understood. Bismuth citrate has been used as an antacid for decades, but it does not have any anti-inflammatory properties and should not be used for this purpose.</p>Fórmula:C6H5BiO7Pureza:Min. 95%Forma y color:PowderPeso molecular:398.08 g/molHemokinin 1 (human) trifluoroacetate salt
CAS:<p>Hemokinin-1 is a hematopoietic cell growth factor that belongs to the group of neuropeptides. This protein has been shown to stimulate the production of white blood cells and is used as an adjuvant in vaccines. Hemokinin-1 stimulates the production of inflammatory cytokines and other proinflammatory substances. It also has been found to be involved in autoimmune diseases, cancer, and infectious diseases. The antigen binding site on Hemokinin-1 is located at residues Thr-Gly-Lys-Ala-Ser-Gln-Phe-Phe-Gly-Leu (TGLKSGPFGL) and the receptor binding site at residues Met-NH2. The receptor for Hemokinin 1 is the neurokinin 1 receptor (NK1R).</p>Fórmula:C54H84N14O14SPureza:Min. 95%Peso molecular:1,185.4 g/molNeuroendocrine Regulatory Peptide-1 (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-1 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C110H180N32O38Pureza:Min. 95%Peso molecular:2,558.8 g/mol(β-Asp3)-VIP (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Beta-Asp3)-VIP (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C147H238N44O42SPureza:Min. 95%Peso molecular:3,325.8 g/molDiethyl 3-oxoglutarate
CAS:<p>Diethyl 3-oxoglutarate is a sodium salt of a diethyl ester of malonic acid. It has been shown to be cytotoxic in vitro and in vivo, but its mechanism of action is not well understood. Diethyl 3-oxoglutarate may be involved in the production of reactive oxygen species and the induction of DNA damage by alkylating DNA. The compound has also been shown to have anti-inflammatory properties, which may be due to its ability to inhibit the production of prostaglandins.</p>Fórmula:C9H14O5Pureza:Min. 95%Peso molecular:202.2 g/molACTH (7-38) (human)
CAS:<p>ACTH is a hormone that is produced by the anterior lobe of the pituitary gland. It stimulates the release of cortisol from the adrenal cortex. ACTH (7-38) has been shown to have cytosolic Ca2+ channel-blocking and antimicrobial activities, as well as an effect on defensin production in human neutrophils. ACTH (7-38) also has been shown to inhibit cytokine production in rat astrocytes, and to stimulate prostaglandin synthesis in mouse fibroblasts. This peptide also has been shown to have physiological effects on bowel disease and inflammatory bowel disease.</p>Fórmula:C167H257N47O46Pureza:Min. 95%Peso molecular:3,659.12 g/mol(Tyr27)-α-CGRP (27-37) (canine, mouse, rat)
CAS:<p>Please enquire for more information about (Tyr27)-alpha-CGRP (27-37) (canine, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C54H79N13O17Pureza:Min. 95%Peso molecular:1,182.28 g/mol(Tyr0)-BNP-32 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Tyr0)-BNP-32 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C152H253N51O44S4Pureza:Min. 95%Peso molecular:3,627.22 g/moluPAR (84-95) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about uPAR (84-95) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C62H98N18O20SPureza:Min. 95%Peso molecular:1,447.62 g/molAdrenomedullin (11-50) (rat)
CAS:<p>Please enquire for more information about Adrenomedullin (11-50) (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C194H304N58O59S4Pureza:Min. 95%Peso molecular:4,521.11 g/molAmylin (mouse, rat) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Fórmula:C167H272N52O53S2Pureza:Min. 95%Peso molecular:3,920.4 g/mol(Des-Glu5)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Glu5)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C131H203N39O28SPureza:Min. 95%Peso molecular:2,804.33 g/molβ-CGRP (human)
CAS:<p>Please enquire for more information about Beta-CGRP (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C162H267N51O48S3Pureza:Min. 95%Peso molecular:3,793.37 g/mol(Nle 8·21,Tyr34)-pTH (1-34) amide (rat)
CAS:<p>Please enquire for more information about (Nle 8·21,Tyr34)-pTH (1-34) amide (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C182H296N56O48Pureza:Min. 95%Peso molecular:4,036.65 g/molAtriopeptin I (rat)
CAS:<p>Atriopeptin I is a peptide hormone that is produced in the rat mesenteric gland. It has been shown to have β-amino acid, diagnostic agents, ph optimum, and receptor activity. Atriopeptin I has been found to have atrial natriuretic effects and may be useful for the treatment of infectious diseases. Atriopeptin I has also been shown to bind with a monoclonal antibody and enzyme inhibitors as well as having a disulfide bond. The biological function of this peptide hormone is not yet known, but it is thought to be involved in fatty acid metabolism.</p>Fórmula:C83H135N29O30S2Pureza:Min. 95%Peso molecular:2,083.27 g/molTetraethylammonium tetrafluoroborate
CAS:<p>Tetraethylammonium tetrafluoroborate is a diamagnetic chemical species that reacts with water, forming the hydrated salt tetraethylammonium hydroxide. Tetraethylammonium tetrafluoroborate has a high resistance to oxidation and reduction reactions. It can be used as an electrolyte in electrochemistry and as a thermal expansion agent in plastics. The potentials of this substance are around +1 V, which makes it useful for electrochemical impedance spectroscopy. Tetraethylammonium tetrafluoroborate is activated by organic solvents, but not by water vapor.</p>Fórmula:C8H20N·BF4Forma y color:White Off-White PowderPeso molecular:217.06 g/mol([13C6]Leu5)-Ghrelin (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about ([13C6]Leu5)-Ghrelin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Galanin-Like Peptide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Galanin-Like Peptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C292H451N83O84SPureza:Min. 95%Peso molecular:6,500.28 g/molα-CGRP (19-37) (human)
CAS:<p>Please enquire for more information about Alpha-CGRP (19-37) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C86H137N25O25Pureza:Min. 95%Peso molecular:1,921.16 g/molPeptide YY (13-36) (canine, mouse, porcine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Peptide YY (13-36) (canine, mouse, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C135H209N41O38Pureza:Min. 95%Peso molecular:3,014.36 g/molOrotic acid hydrate
CAS:<p>Orotic acid hydrate is a synthetic compound that is designed to be a growth regulator. Orotic acid hydrate is synthesized by reacting the orotate with pyridoxine hydrochloride, followed by crystallizing the product. Hydrogen bonds form between the water molecules and fatty acids in the crystals of OA hydrate. These hydrogen bonds stabilize the crystal structure and allow for its use as a growth regulator. The stability of this molecule can also be attributed to its ability to form hydrogen bonds with other molecules such as α-tocopherol, calcium carbonate, and synthetic cannabinoids. Orotic acid hydrate has been shown to have an effect on cancer cells because it reacts with daunorubicin in solution and inhibits DNA synthesis, inhibiting cell growth.</p>Fórmula:C5H4N2O4·H2OPureza:Min. 95 Area-%Forma y color:PowderPeso molecular:174.11 g/molPneumadin (human)
CAS:<p>Please enquire for more information about Pneumadin (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C41H70N12O14Pureza:Min. 95%Peso molecular:955.07 g/molMonocyte Chemotactic Protein-1 (human) acetate salt
CAS:<p>Please enquire for more information about Monocyte Chemotactic Protein-1 (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C379H610N108O114S5Pureza:Min. 95%Peso molecular:8,663.89 g/molApelin-12 (human, bovine, mouse, rat)
CAS:<p>Apelin-12 is a peptide hormone that belongs to the group of apelin family. It is an endogenous agonist for the apelin receptor and has been shown to affect metabolic and cardiovascular regulation. Apelin-12 has been found to increase systolic blood pressure, which may be due to its ability to inhibit the synthesis of nitric oxide in the heart. It also exhibits anti-inflammatory properties, which have been shown in vivo using a model of colitis induced by dextran sulfate sodium (DSS). The biological properties of this hormone are not yet fully understood. However, it is known that it has effects on cardiac contractility and myocardial infarct size in vivo. Further investigation into this protein's role in inflammatory diseases and metabolic disorders may lead to new treatments for these conditions.</p>Fórmula:C64H103N21O14SPureza:Min. 95%Peso molecular:1,422.7 g/molpTH (18-48) (human)
CAS:<p>Please enquire for more information about pTH (18-48) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C156H251N47O43SPureza:Min. 95%Peso molecular:3,505.02 g/mol(Des-His1,Glu9)-Glucagon (1-29) amide (human, rat, porcine)
CAS:<p>Please enquire for more information about (Des-His1,Glu9)-Glucagon (1-29) amide (human, rat, porcine) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C148H221N41O47SPureza:Min. 95%Peso molecular:3,358.65 g/molIntermedin (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Intermedin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C226H361N75O64S2Pureza:Min. 95%Peso molecular:5,216.88 g/molGalanin (1-16) (mouse, porcine, rat)
CAS:<p>Please enquire for more information about Galanin (1-16) (mouse, porcine, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C78H116N20O21Pureza:Min. 95%Peso molecular:1,669.88 g/molUroguanylin Topoisomer B (human) trifluoroacetate salt
<p>Please enquire for more information about Uroguanylin Topoisomer B (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C64H102N18O26S4Pureza:Min. 95%Peso molecular:1,667.86 g/mol(Leu31,Pro34)-Neuropeptide Y (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Leu31,Pro34)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C189H284N54O56SPureza:Min. 95%Peso molecular:4,240.67 g/molSodium potassium tartrate tetrahydrate
CAS:<p>Sodium potassium tartrate tetrahydrate is a crystal compound made up of potassium and sodium. It is a ferroelectric material that exhibits polarization and piezoelectric properties. The growth rate of these crystals can be controlled by using inhibitors such as protein kinase inhibitors. Sodium potassium tartrate tetrahydrate has been shown to have inhibitory activity against certain enzymes, including proteases and kinases. Additionally, it exhibits dielectric properties and can be used in the production of capacitors and other electronic components.</p>Fórmula:C4H4KNaO6·4H2OPureza:Min. 95%Forma y color:White PowderPeso molecular:282.22 g/molAmylin (8-37) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amylin (8-37) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C138H216N42O45Pureza:Min. 95%Peso molecular:3,183.45 g/molMinigastrin I tifluoroacetic acid
CAS:<p>Please enquire for more information about Minigastrin I tifluoroacetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C74H99N15O26S•(CF3CO2H)xPureza:Min. 95%Peso molecular:1,646.73 g/mol(Tyr38,Phe42·46)-Osteocalcin (38-49) (human)
CAS:<p>Please enquire for more information about (Tyr38,Phe42·46)-Osteocalcin (38-49) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C73H101N19O17Pureza:Min. 95%Peso molecular:1,516.7 g/mol([13C6]Leu6)-Endothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate salt
<p>Please enquire for more information about ([13C6]Leu6)-Endothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%pTH-Related Protein (1-16) (human, mouse, rat)
CAS:<p>Please enquire for more information about pTH-Related Protein (1-16) (human, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C77H128N24O25Pureza:Min. 95%Peso molecular:1,789.99 g/molNeuropeptide S (1-10) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide S (1-10) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C42H68N14O14SPureza:Min. 95%Peso molecular:1,025.14 g/molFibrinopeptide B (human) trifluoroacetate salt
CAS:<p>Fibrinopeptide B is a fibrinogen-derived peptide that has shown to inhibit the growth of HL-60 cells. It may be active as a receptor antagonist for thrombin and caproic acid. Fibrinopeptide B also inhibits angiogenesis by inhibiting the binding of acidic, basic proteins to the vascular endothelium in atherosclerotic lesions. The biological sample can be obtained from human serum or plasma.</p>Fórmula:C66H93N19O25Pureza:Min. 95%Peso molecular:1,552.56 g/molEndothelin-1 (human, bovine, dog, mouse, porcine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Endothelin-1 (human, bovine, dog, mouse, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C109H159N25O32S5·C2HF3O2Pureza:Min. 95%Peso molecular:2,605.93 g/molTyr-Proinsulin C-Peptide (55-89) (human)
CAS:<p>Please enquire for more information about Tyr-Proinsulin C-Peptide (55-89) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C162H268N50O54Pureza:Min. 95%Peso molecular:3,780.17 g/molMCH-Gene-Overprinted-Polypeptide-27 (rat)
CAS:<p>Please enquire for more information about MCH-Gene-Overprinted-Polypeptide-27 (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C145H227N39O40S4Pureza:Min. 95%Peso molecular:3,284.86 g/molpTH (2-38) (human) acetate salt
CAS:<p>Please enquire for more information about pTH (2-38) (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C194H314N58O53S2Pureza:Min. 95%Peso molecular:4,371.06 g/molIL-1β (163-171) (human) trifluoroacetate salt
CAS:<p>Interleukin-1 beta (IL-1β) is a cytokine that is produced by activated macrophages and T cells. It is an important regulator of immune function, inducing fever, activating the inflammatory response, and increasing vascular permeability. IL-1β is a 163-amino acid polypeptide with a molecular weight of 18.7 kDa. The trifluoroacetate salt of IL-1β has been shown to be active in vitro against human leukemic cells and to have an interferon-gamma activity in vitro.</p>Fórmula:C39H64N12O19Pureza:Min. 95%Peso molecular:1,004.99 g/mol(Tyr0)-C-Type Natriuretic Peptide (32-53) (human, porcine, rat)
CAS:<p>Please enquire for more information about (Tyr0)-C-Type Natriuretic Peptide (32-53) (human, porcine, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C102H166N28O30S3Pureza:Min. 95%Peso molecular:2,360.78 g/molPAR-4 (1-6) amide (mouse) trifluoroacetate salt
CAS:<p>PAR-4 (1-6) amide (mouse) trifluoroacetate salt H-Gly-Tyr-Pro-Gly-Lys-Phe-NH2 trifluoroacetate salt is a guanine nucleotide binding protein that belongs to the PAR family of proteins. It is expressed in wild type mice and binds to the cytosolic calcium, which regulates polymerase chain reaction. PAR-4 (1-6) amide (mouse) trifluoroacetate salt H-Gly-Tyr-Pro-Gly-Lys-Phe NH2 trifluoroacetate salt can be used as a potential drug target for epidermal growth factor. It has been shown to activate transcription polymerase chain and transcriptase polymerase chain during transcriptional regulation of messenger RNA.</p>Fórmula:C33H46N8O7Pureza:Min. 95%Peso molecular:666.77 g/molNeuropeptide Y (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C189H285N55O57SPureza:Min. 95%Peso molecular:4,271.69 g/molAsn-Ala-Intercellular Adhesion Molecule 1 (1-21) (human)
CAS:<p>Please enquire for more information about Asn-Ala-Intercellular Adhesion Molecule 1 (1-21) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C99H173N29O32SPureza:Min. 95%Peso molecular:2,313.68 g/molTLQP-21 (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about TLQP-21 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C107H170N40O26Pureza:Min. 95%Peso molecular:2,432.75 g/molβ-MSH (human) trifluoroacetate salt
CAS:<p>Beta-MSH is a hormone that belongs to the peptide hormones group. It is synthesized in the pituitary gland and released in response to stress, trauma or injury. Beta-MSH has been shown to regulate many physiological functions, including adrenocorticotrophic hormone (ACTH) secretion, skin pigmentation and regulation of body temperature. Beta-MSH also has diagnostic applications as it can be used to measure levels of this hormone in cerebrospinal fluid (CSF). The n-terminal prohormone fragment of beta-MSH can be measured by radioimmunoassay (RIA) or enzyme immunoassay (EIA), while the c-terminal prohormone fragment can be measured by RIA.</p>Fórmula:C118H174N34O35SPureza:Min. 95%Peso molecular:2,660.92 g/molpTH (1-37) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about pTH (1-37) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C195H316N58O54S2Pureza:Min. 95%Peso molecular:4,401.09 g/molGLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about GLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C184H273N51O57Pureza:Min. 95%Peso molecular:4,111.45 g/molpTH (1-34) (rat)
CAS:<p>Please enquire for more information about pTH (1-34) (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C180H291N55O48S2Pureza:Min. 95%Peso molecular:4,057.71 g/molProlactin-Releasing Peptide (12-31) (human)
CAS:<p>Please enquire for more information about Prolactin-Releasing Peptide (12-31) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C104H158N32O26Pureza:Min. 95%Peso molecular:2,272.57 g/molPancreatic Polypeptide (1-17)-(Ala31, Aib 32)-Neuropeptide Y (18-36) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Pancreatic Polypeptide (1-17)-(Ala31, Aib 32)-Neuropeptide Y (18-36) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C189H287N55O53SPureza:Min. 95%Peso molecular:4,209.71 g/molHIV Protease Substrate VII
CAS:<p>Please enquire for more information about HIV Protease Substrate VII including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C52H81N15O14Pureza:Min. 95%Peso molecular:1,140.29 g/molFGF basic (1-24) (human, bovine)
CAS:<p>Please enquire for more information about FGF basic (1-24) (human, bovine) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C118H173N31O33Pureza:Min. 95%Peso molecular:2,553.83 g/molGalanin (mouse, rat)
CAS:<p>Structure/Function: mouse, rat</p>Fórmula:C141H211N43O41Pureza:Min. 95%Peso molecular:3,164.45 g/molPiperazine citrate
CAS:<p>Please enquire for more information about Piperazine citrate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:(C4H10N2)3·(C6H8O7)2Pureza:Min. 95%Forma y color:PowderPeso molecular:642.65 g/molC-Type Natriuretic Peptide (1-53) (human) acetate salt
CAS:<p>Acetate salt</p>Fórmula:C251H417N81O71S3Pureza:Min. 95%Peso molecular:5,801.7 g/molIL-1β (178-207) (human)
CAS:<p>Please enquire for more information about IL-1beta (178-207) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C157H256N38O49SPureza:Min. 95%Peso molecular:3,492.01 g/molProcathepsin B (26-50) (rat)
CAS:<p>Please enquire for more information about Procathepsin B (26-50) (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C123H198N34O33SPureza:Min. 95%Peso molecular:2,713.16 g/molAcetyl-PACAP-38 (human, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-PACAP-38 (human, mouse, ovine, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C205H333N63O54SPureza:Min. 95%Peso molecular:4,576.3 g/mol(Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C107H162N30O30Pureza:Min. 95%Peso molecular:2,348.62 g/molAdenine sulfate dihydrate
CAS:<p>Adenine sulfate dihydrate is an important component of the energy-producing process in mitochondria. Adenine sulfate dihydrate is a necessary cofactor for many metabolic reactions, including those that produce ATP and NADH. It has been shown to promote growth factor activity and stimulate cell proliferation. Adenine sulfate dihydrate can be used as a nutrient solution in recombinant protein production, where it is required for the expression of recombinant proteins in E. coli or mammalian cells. This compound also plays an important role in the glycosylation of proteins during their synthesis on ribosomes and may have implications for protein folding and stability.</p>Fórmula:(C5H5N5)2•(H2O)2•H2SO4Pureza:Min. 95%Forma y color:PowderPeso molecular:404.36 g/molObestatin (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Obestatin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C116H176N32O33Pureza:Min. 95%Peso molecular:2,546.83 g/molpTH (7-84) (human) trifluoroacetate salt
<p>Please enquire for more information about pTH (7-84) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C381H629N119O115S2Pureza:Min. 95%Peso molecular:8,780.94 g/mol5-FAM-Amylin (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about 5-FAM-Amylin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C188H282N52O59S2Pureza:Min. 95%Peso molecular:4,278.7 g/molDnp-Pro-TNF-α (71-82) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Dnp-Pro-TNF-alpha (71-82) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C57H94N22O21Pureza:Min. 95%Peso molecular:1,423.49 g/mol(Tyr15)-Fibrinopeptide B (human)
CAS:<p>Fibrinopeptide B is a linear peptide that is found in the human fibrinogen molecule. It has been shown to be bioactive and can be used as a specific molecular marker for thrombus formation. Fibrinopeptide B has an optimal wavelength of 280 nm, and can be detected using phosphoric acid-based electrophoresis. The peptides are typically only 10 to 20 amino acids long, although the length varies depending on the protein they are derived from.</p>Fórmula:C75H102N20O27Pureza:Min. 95%Peso molecular:1,715.73 g/molC-Peptide (human) trifluoroacetate salt
CAS:<p>C-Peptide is a monoclonal antibody that binds to the β-cell and inhibits insulin release. It has been used in diagnosis of type 1 diabetes mellitus. C-Peptide is a hormone that regulates blood glucose levels by controlling the rate of glucose production in the liver, as well as by inhibiting the breakdown of glycogen in the liver. The C-terminal amino acid sequence Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu -Leu-Gly can be cleaved from the peptide by trifluoroacetic acid to yield free Gln, which can then be detected using mass spectrometry. Growth factors such as IGF1, FGF21, and HGF have been shown to increase C peptide levels in diabetic patients.</p>Fórmula:C129H211N35O48Pureza:Min. 95%Peso molecular:3,020.26 g/molAcetyl-ACTH (2-24) (human, bovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-ACTH (2-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C135H207N39O30SPureza:Min. 95%Peso molecular:2,888.4 g/mol(Phe1,Ser2,Tyr6)-PAR-1 (1-6) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Phe1,Ser2,Tyr6)-PAR-1 (1-6) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C39H60N10O8Pureza:Min. 95%Peso molecular:796.96 g/molIL-1α (223-250) (human)
CAS:<p>Please enquire for more information about IL-1alpha (223-250) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C158H219N37O44Pureza:Min. 95%Peso molecular:3,340.65 g/molPlatelet Factor 4 (58-70) (human)
CAS:<p>Please enquire for more information about Platelet Factor 4 (58-70) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C76H133N17O18Pureza:Min. 95%Peso molecular:1,572.97 g/mol(+)-Diisopropyl L-tartrate
CAS:<p>(+)-Diisopropyl L-tartrate is a chiral, hydrophobic, synthetic chemical that is soluble in organic solvents. It has been used as an intermediate for the synthesis of other compounds such as aldehydes and threonine. (+)-Diisopropyl L-tartrate is also used to separate mixtures of enantiomers. This compound has been shown to be effective at extracting styrene from gasoline or methyl esters from crude oil. The optimal extraction temperature is between 60°C and 100°C.</p>Fórmula:C10H18O6Pureza:Min. 95%Forma y color:Clear LiquidPeso molecular:234.25 g/molCalcium chloride dihydrate
CAS:<p>Calcium chloride dihydrate is a chemical compound that is used in the preparation of buffers, as well as in polymer synthesis and analytical chemistry. It is also used in the treatment of low blood calcium levels, which may occur from chronic kidney failure, malnutrition or malabsorption. Calcium chloride dihydrate has been shown to inhibit the proliferation of various cancer cells, including prostate cancer cells. This inhibition has been shown to be due to its ability to significantly cytotoxic effects on these cells. The cytotoxicity was found to be due to lysosomal membrane permeabilization and Ca2+ influx into the cell leading to apoptosis induction.</p>Fórmula:CaCl2•(H2O)2Pureza:Min. 95%Forma y color:White Clear LiquidPeso molecular:147.01 g/molAcetyl-Neurotrophin Receptor (368-381) amide (human)
CAS:<p>Please enquire for more information about Acetyl-Neurotrophin Receptor (368-381) amide (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C69H124N22O19Pureza:Min. 95%Peso molecular:1,565.86 g/molLithium bis(oxalato)borate
CAS:<p>Lithium bis(oxalato)borate (LBBO), also known as Lithiumbis(oxalato)borate, is a lithium salt of the borate ester. The optimum concentration for LBBO is 1-2 mol/L. LBBO is soluble in water and reacts with glycol esters to form lithium glycolates. This reaction is reversible and the equilibrium can be shifted by changing the temperature or pressure. The NMR spectra of LBBO show a peak at 3.3 ppm which corresponds to the carbon atom attached to the carbonyl group, which is indicative of an organic solution.<br>LBBO has been shown to be an electrolyte for lithium ion batteries but it has not been studied extensively because it decomposes at temperatures above 400°C and exhibits poor transport properties, limiting its application in electronic devices.</p>Fórmula:C4BO8•LiPureza:Min. 95%Peso molecular:193.79 g/molC5a Anaphylatoxin (human) trifluoroacetate salt )
CAS:<p>Please enquire for more information about C5a Anaphylatoxin (human) trifluoroacetate salt ) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C350H578N108O107S8Pureza:Min. 95%Peso molecular:8,267.53 g/molExperimental Allergic Encephalitogenic Peptide (human)
CAS:<p>Experimental Allergic Encephalitogenic Peptide (human) H-Phe-Ser-Trp-Gly-Ala-Glu-Gly-Gln-Arg-OH is a protein that is used as an adjuvant to increase the immune response. It is composed of a string of amino acids that are recognized by the immune system, but do not elicit an immune response on their own. The peptide can be administered intracutaneously or in the form of a vaccine. This peptide has been shown to have a basic nature and has been found to have lethal effects when administered at high doses.</p>Fórmula:C46H64N14O14Pureza:Min. 95%Peso molecular:1,037.09 g/molAlarin (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Alarin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C119H199N45O35Pureza:Min. 95%Peso molecular:2,820.14 g/molTyrosinase (243-251) (human) acetate salt
CAS:<p>H-KCDICTDEY-OH peptide, corresponding to amino acids 243-251 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>Fórmula:C44H68N10O18S2Pureza:Min. 95%Peso molecular:1,089.2 g/molEuropium tris[3-(heptafluoropropylhydroxymethylene)-(+)-camphorate]
CAS:<p>Europium Tris[3-(Heptafluoropropylhydroxymethylene)-(+)-Camphorate] is a chiral compound that can be used as a catalyst for the asymmetric synthesis of spiroketals. The catalyst is immobilized on a monolayer and has been shown to work with nitrogen nucleophiles such as ammonia and amines. It also shows catalytic activity in hydrosilylation reactions, which are used in the production of polymers. Europium Tris[3-(Heptafluoropropylhydroxymethylene)-(+)-Camphorate] is soluble in organic solvents such as ethyl diazoacetate, styrene, and tetrahydrofuran.</p>Fórmula:C42H42EuF21O6Pureza:Min. 95%Peso molecular:1,193.71 g/mol(Gly1,Ser3·22,Gln4·34,Thr6,Arg19,Tyr21,Ala23·31, Aib 32)-Pancreatic Polypeptide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Gly1,Ser3·22,Gln4·34,Thr6,Arg19,Tyr21,Ala23·31, Aib 32)-Pancreatic Polypeptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C183H281N57O54S2Pureza:Min. 95%Peso molecular:4,207.67 g/molOxalic acid dihydrate
CAS:<p>Oxalic acid dihydrate is an organic compound with the molecular formula of (C2H2O4)2. It has a molecular weight of 226.07 g/mol and a melting point of 173°C. The intermolecular hydrogen bonding between the hydroxyl groups and the fatty acid chains creates an oxalic acid molecule that is able to exist in two different structures, alpha and beta. Alpha oxalic acid molecules have a particle phase transition temperature of -10°C, while beta oxalic acid molecules have a particle phase transition temperature of 30°C. Oxalic acid dihydrate is soluble in n-dimethylformamide (DMF) and hydrochloric acid (HCl). br>br> Oxalic acid dihydrate is used as an additive in metal-working fluids, which are used during machining processes to prevent corrosion. It also acts as a catalyst for transfer reactions between phosphorus pentoxide</p>Fórmula:C2H2O4•(H2O)2Pureza:Min. 95%Peso molecular:126.07 g/mol1-Benzyl-3-piperidone HCl hydrate
CAS:<p>1-Benzyl-3-piperidone HCl hydrate is a synthetic organic compound that is used as a neutralizing agent in industrial processes. It is typically used in the extraction of metal ions from an acid solution, although it can also be used as a catalyst for chemical reactions. The neutralization reaction product, 1-benzyl-3-piperidone, has been reported to have significant antibacterial activity. The use of 1-benzyl-3-piperidone HCl hydrate may be limited by its high cost and toxicity.</p>Fórmula:C12H15NO·HCl·xH2OPureza:Min. 95%Forma y color:PowderPeso molecular:225.71 g/mol
