Compuestos relacionados con enzimas, péptidos y proteínas

<p>Please enquire for more information about Orphan GPCR SP9155 Agonist P550 (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>PACAP-38 is a peptide that has been shown to have a variety of physiological effects, including the regulation of brain functions and immunological responses. PACAP-38 has been found to bind to toll-like receptor 4 (TLR4) in macrophages and neutrophils, which stimulates the production of proinflammatory cytokines. It also interacts with adenylate cyclase, which leads to an increase in cAMP levels. This may be the mechanism by which PACAP-38 regulates brain functions. The biological function of PACAP-38 is not yet clear but it may act as a signal peptide, regulating protein synthesis and gene expression.</p>

<p>Please enquire for more information about (Hyp 474·477,Gln479)-cyclo-a-Fetoprotein (471-479) (human, lowland gorilla) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>IL-1beta is a pro-inflammatory cytokine that belongs to the group of interleukins. It is synthesized as a preproprotein which undergoes proteolytic processing to produce a mature 34 kDa protein with an N-terminal lys-pro sequence. IL-1beta has been shown to induce allergic reactions in animals and humans, constrictions in airways, and antigen presentation by antigen presenting cells, such as macrophages and dendritic cells. This cytokine also has costimulatory effects on immune responses and has been shown to be involved in autoimmune diseases and inflammatory diseases. The IL-1beta gene contains a hydroxyl group at the COOH terminus that allows for the formation of an aspirin binding site.</p>

<p>Please enquire for more information about Adrenomedullin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about PACAP-38 (31-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about (Tyr0)-Atriopeptin II (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Pyr 16)-VIP (16-28) (human, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Biotinyl-Atrial Natriuretic Factor (1-28) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about N,N'-Dimethyl-2,7-Diazapyrenium bistetrafluoroborate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuromedin S (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Prokineticin-2 is a protein that is encoded by the PROK2 gene. It has been shown to inhibit VEGF in vitro and to be anti-inflammatory. Prokineticin-2 binds to the receptor for colony stimulating factor 1 (CSF1) and promotes angiogenesis by inducing the production of angiogenic factors such as vascular endothelial growth factor (VEGF), erythropoietin, and granulocyte macrophage colony stimulating factor (GM-CSF). It also inhibits transcriptional regulation of genes involved in inflammation, including IL-10, which inhibits IL-12 production.</p>

<p>Bismuth citrate is an antimicrobial agent that is used to treat helicobacter pylori infections. Bismuth citrate may be an alternative to clarithromycin and metronidazole for the treatment of antibiotic-resistant strains of helicobacter. It has been shown to improve duodenal ulcer healing and reduce the incidence of gastric ulcers in a group of patients with duodenal ulcer disease. This drug has also been shown to significantly reduce the incidence of gastric cancer in patients with Helicobacter pylori infection. Bismuth citrate is a polymeric compound that is thought to bind to the bacterial cell wall and inhibit its growth through inhibition of protein synthesis, but this mechanism is not well understood. Bismuth citrate has been used as an antacid for decades, but it does not have any anti-inflammatory properties and should not be used for this purpose.</p>

<p>Hemokinin-1 is a hematopoietic cell growth factor that belongs to the group of neuropeptides. This protein has been shown to stimulate the production of white blood cells and is used as an adjuvant in vaccines. Hemokinin-1 stimulates the production of inflammatory cytokines and other proinflammatory substances. It also has been found to be involved in autoimmune diseases, cancer, and infectious diseases. The antigen binding site on Hemokinin-1 is located at residues Thr-Gly-Lys-Ala-Ser-Gln-Phe-Phe-Gly-Leu (TGLKSGPFGL) and the receptor binding site at residues Met-NH2. The receptor for Hemokinin 1 is the neurokinin 1 receptor (NK1R).</p>

<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-1 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Beta-Asp3)-VIP (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Diethyl 3-oxoglutarate is a sodium salt of a diethyl ester of malonic acid. It has been shown to be cytotoxic in vitro and in vivo, but its mechanism of action is not well understood. Diethyl 3-oxoglutarate may be involved in the production of reactive oxygen species and the induction of DNA damage by alkylating DNA. The compound has also been shown to have anti-inflammatory properties, which may be due to its ability to inhibit the production of prostaglandins.</p>

<p>ACTH is a hormone that is produced by the anterior lobe of the pituitary gland. It stimulates the release of cortisol from the adrenal cortex. ACTH (7-38) has been shown to have cytosolic Ca2+ channel-blocking and antimicrobial activities, as well as an effect on defensin production in human neutrophils. ACTH (7-38) also has been shown to inhibit cytokine production in rat astrocytes, and to stimulate prostaglandin synthesis in mouse fibroblasts. This peptide also has been shown to have physiological effects on bowel disease and inflammatory bowel disease.</p>

<p>Please enquire for more information about (Tyr27)-alpha-CGRP (27-37) (canine, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Tyr0)-BNP-32 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about uPAR (84-95) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Adrenomedullin (11-50) (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about (Des-Glu5)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Beta-CGRP (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Nle 8·21,Tyr34)-pTH (1-34) amide (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Atriopeptin I is a peptide hormone that is produced in the rat mesenteric gland. It has been shown to have β-amino acid, diagnostic agents, ph optimum, and receptor activity. Atriopeptin I has been found to have atrial natriuretic effects and may be useful for the treatment of infectious diseases. Atriopeptin I has also been shown to bind with a monoclonal antibody and enzyme inhibitors as well as having a disulfide bond. The biological function of this peptide hormone is not yet known, but it is thought to be involved in fatty acid metabolism.</p>

<p>Tetraethylammonium tetrafluoroborate is a diamagnetic chemical species that reacts with water, forming the hydrated salt tetraethylammonium hydroxide. Tetraethylammonium tetrafluoroborate has a high resistance to oxidation and reduction reactions. It can be used as an electrolyte in electrochemistry and as a thermal expansion agent in plastics. The potentials of this substance are around +1 V, which makes it useful for electrochemical impedance spectroscopy. Tetraethylammonium tetrafluoroborate is activated by organic solvents, but not by water vapor.</p>

<p>Please enquire for more information about ([13C6]Leu5)-Ghrelin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Galanin-Like Peptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Alpha-CGRP (19-37) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Peptide YY (13-36) (canine, mouse, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Orotic acid hydrate is a synthetic compound that is designed to be a growth regulator. Orotic acid hydrate is synthesized by reacting the orotate with pyridoxine hydrochloride, followed by crystallizing the product. Hydrogen bonds form between the water molecules and fatty acids in the crystals of OA hydrate. These hydrogen bonds stabilize the crystal structure and allow for its use as a growth regulator. The stability of this molecule can also be attributed to its ability to form hydrogen bonds with other molecules such as α-tocopherol, calcium carbonate, and synthetic cannabinoids. Orotic acid hydrate has been shown to have an effect on cancer cells because it reacts with daunorubicin in solution and inhibits DNA synthesis, inhibiting cell growth.</p>

<p>Please enquire for more information about Pneumadin (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Monocyte Chemotactic Protein-1 (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Apelin-12 is a peptide hormone that belongs to the group of apelin family. It is an endogenous agonist for the apelin receptor and has been shown to affect metabolic and cardiovascular regulation. Apelin-12 has been found to increase systolic blood pressure, which may be due to its ability to inhibit the synthesis of nitric oxide in the heart. It also exhibits anti-inflammatory properties, which have been shown in vivo using a model of colitis induced by dextran sulfate sodium (DSS). The biological properties of this hormone are not yet fully understood. However, it is known that it has effects on cardiac contractility and myocardial infarct size in vivo. Further investigation into this protein's role in inflammatory diseases and metabolic disorders may lead to new treatments for these conditions.</p>

<p>Please enquire for more information about pTH (18-48) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-His1,Glu9)-Glucagon (1-29) amide (human, rat, porcine) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Intermedin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Galanin (1-16) (mouse, porcine, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Uroguanylin Topoisomer B (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Leu31,Pro34)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Sodium potassium tartrate tetrahydrate is a crystal compound made up of potassium and sodium. It is a ferroelectric material that exhibits polarization and piezoelectric properties. The growth rate of these crystals can be controlled by using inhibitors such as protein kinase inhibitors. Sodium potassium tartrate tetrahydrate has been shown to have inhibitory activity against certain enzymes, including proteases and kinases. Additionally, it exhibits dielectric properties and can be used in the production of capacitors and other electronic components.</p>

<p>Please enquire for more information about Amylin (8-37) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Minigastrin I tifluoroacetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Tyr38,Phe42·46)-Osteocalcin (38-49) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about ([13C6]Leu6)-Endothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about pTH-Related Protein (1-16) (human, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>