Anticuerpos primarios

<p>Rabbit polyclonal PSMB7 antibody</p>

<p>This antibody reacts with heavy (mu) chains on mouse IgM.</p>

<p>SYT11 antibody was raised in rabbit using the N terminal of SYT11 as the immunogen</p>

<p>Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.</p>

<p>The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.</p>

<p>The PCBP2 antibody is a highly specialized Polyclonal Antibody that has neutralizing properties against enzyme activities. It is commonly used in flow immunoassay techniques to detect and quantify the presence of inhibitory factors in primary cells. This antibody specifically targets the cytokine family, particularly interleukin-6, which plays a crucial role in immune response regulation. The PCBP2 antibody is also effective in inhibiting protease activity and interferon signaling pathways. Its high substrate specificity and strong DNA binding activity make it a valuable tool for researchers studying various cellular processes and molecular interactions. With its exceptional performance and reliability, the PCBP2 antibody is an essential component in any immunological research project.</p>

<p>SDK1 antibody was raised in rabbit using the middle region of SDK1 as the immunogen</p>

<p>Goat anti-rabbit IgG (H+L) (biotin) was raised in goat using rabbit IgG, whole molecule as the immunogen.</p>

<p>PEX5 antibody was raised using the middle region of PEX5 corresponding to a region with amino acids LNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLL</p>

<p>The CYP2A6 antibody is a monoclonal antibody that targets the protein kinase CYP2A6. This antibody can be used for various applications, including immunohistochemical detection and clinical use as a medicament. CYP2A6 is an enzyme that plays a crucial role in the metabolism of several compounds, including cotinine. It is also involved in the activation of procarcinogens and the detoxification of xenobiotics. The CYP2A6 antibody can be used to study the expression and localization of CYP2A6 in different tissues and cell types, making it a valuable tool in life sciences research. Additionally, this antibody may have potential applications in the development of novel antibacterial agents.</p>

<p>The SMAD6 antibody is a monoclonal antibody that has the ability to neutralize specific virus surface antigens. This antibody specifically targets and binds to the superoxide glucagon receptor, preventing its activation and subsequent signaling cascade. As a result, the antibody inhibits the nuclear translocation of specific antibodies involved in viral replication and immune evasion.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. The effectiveness of this drug has been extensively studied using advanced techniques such as the patch-clamp technique on human erythrocytes. Furthermore, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds specifically to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK</p>

<p>VMAT2 antibody was raised in rabbit using a synthetic peptide from C-terminus of rat VMAT2 conjugated to BSA as the immunogen.</p>

<p>MTUS1 antibody was raised using the N terminal of MTUS1 corresponding to a region with amino acids QLLACGNTKFEALTVVIQHLLSEREEALKQHKTLSQELVNLRGELVTAST</p>

<p>C20orf132 antibody was raised using the middle region of C20orf132 corresponding to a region with amino acids PHLENLDTIIKLPLRFQRLGHLVALMALLCGDPQEKVAEEAAEGIHSLLH</p>

<p>GRK5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>The MZF1 antibody is a potent family kinase inhibitor that belongs to the class of antibodies. It specifically targets fibrinogen, a protein involved in blood clotting. This polyclonal antibody has been extensively studied and proven to be effective in inhibiting the activity of fibrinogen. It can be used in various applications in the field of Life Sciences, such as research on dopamine receptors and growth factors. Additionally, this monoclonal antibody has shown inhibitory effects on tyrosine kinases, which play a crucial role in cell signaling pathways. The MZF1 antibody is a valuable tool for scientists and researchers working in the fields of biology, medicine, and pharmacology. Its versatility and specificity make it an essential component in various experiments and studies.</p>

<p>EVX1 antibody was raised in rabbit using the middle region of EVX1 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal DDX56 antibody</p>

<p>Cip1 antibody was raised in rabbit using residues 139-164 of the p21 protein as the immunogen.</p>

<p>GNRHR antibody was raised in Rabbit using Human GNRHR as the immunogen</p>

<p>Affinity Purified Rabbit anti-Human Ferritin Antibody</p>

<p>H, K ATPase antibody was raised in mouse using a 34kDa core peptide purified from deglycosylated hog gastric microsomes as the immunogen.</p>

<p>DYRK1B antibody was raised in Rabbit using Human DYRK1B as the immunogen</p>

<p>Rabbit anti-goat IgG (H + L) (Alk Phos) was raised in rabbit using goat IgG whole molecule as the immunogen.</p>

<p>GTF2H1 antibody was raised in Rabbit using Human GTF2H1 as the immunogen</p>

<p>Rab23 antibody was raised in rabbit using the middle region of Rab23 as the immunogen</p>

<p>The DGKA antibody is a highly specific monoclonal antibody that targets the octanoyltransferase enzyme. It is widely used in various assays and research studies in the field of life sciences. This antibody plays a crucial role in identifying and analyzing the function of DGKA, which is involved in several important cellular processes.</p>

<p>Rabbit polyclonal virD2 antibody (HRP)</p>

<p>FAF1 antibody was raised in rabbit using the C terminal of FAF1 as the immunogen</p>

<p>FGF18 antibody is a polyclonal antibody that targets fibroblast growth factor 18 (FGF18). FGF18 is involved in various biological processes, including hepatocyte growth, tissue repair, and development. This antibody has been shown to have high specificity and affinity for FGF18, making it a valuable tool in life sciences research.</p>

<p>CRP antibody was raised in mouse using human CRP as the immunogen.</p>

<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>

<p>MYBPH antibody was raised using the N terminal of MYBPH corresponding to a region with amino acids LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP</p>

<p>BACE1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Goat polyclonal Human Ceruloplasmin antibody</p>

<p>CD152 antibody (PE) was raised in hamster using murine CD152/CTLA-4 as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Studies have shown its high frequency of human activity using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>The Tau antibody is a mouse monoclonal antibody that is widely used in Life Sciences research. It specifically binds to the peptide sequence of Tau protein, which plays a crucial role in neurodegenerative diseases such as Alzheimer's disease. This antibody has been extensively studied and validated for its high affinity and specificity towards Tau protein.</p>

<p>Affinity purified Rabbit polyclonal XPR1 antibody</p>

<p>Purified Mouse anti-Human Procalcitonin antibody (Clone 1B12)</p>

<p>TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL</p>

<p>GPR116 antibody was raised in Rabbit using Human GPR116 as the immunogen</p>

<p>The C-peptide antibody is a synthetic, recombinant protein that has been activated for use in various life sciences assays. This antibody is specifically designed to detect and bind to C-peptide, a protein fragment that is cleaved from proinsulin during insulin synthesis. The C-peptide antibody can be used in electrophoresis and other laboratory techniques to study the presence and function of C-peptide in human serum samples. This monoclonal antibody is highly specific and has been extensively characterized for its performance and reliability. It can be used as a valuable tool in research and diagnostic applications related to diabetes, insulin secretion, and related disorders. With its buffered formulation and high sensitivity, the C-peptide antibody ensures accurate and reproducible results in various experimental settings. Trust this antibody for your research needs in the field of endocrinology and beyond.</p>

<p>TSH antibody was raised in rabbit using human TSH as the immunogen.</p>

<p>Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.</p>

<p>Calibrator for Cat ELISA Kit</p>

<p>Donkey anti-chicken IgY (H + L) (HRP) was raised in donkey using chicken IgG (H &amp; L) as the immunogen.</p>

<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>

<p>CD30 antibody (FITC) was raised in hamster using recombinant murine CD30 extracellular domain-mouse IgG1 fusion protein as the immunogen.</p>

<p>Rabbit polyclonal GDI2 antibody (biotin)</p>