Anticuerpos primarios

<p>CD4 antibody (FITC) was raised in mouse using chicken CD4 as the immunoge.</p>

<p>Cingulin antibody was raised in mouse using a synthetic peptide corresponding to residues 4-24 of cingulin as the immunogen.</p>

<p>FOS antibody was raised in mouse using recombinant Human V-Fos Fbj Murine Osteosarcoma Viral Oncogene Homolog</p>

<p>The NQO1 Antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. This antibody specifically targets and detects NQO1, an enzyme that plays a crucial role in cellular defense against oxidative stress. It has been extensively studied for its potential as a biomarker in various diseases, including cancer.</p>

<p>The PRCP antibody is a highly specialized antibody used in the field of Life Sciences. It is an autoantibody that specifically targets and binds to the PRCP protein, which plays a crucial role in various cellular processes. This antibody is commonly used for research purposes in laboratories and academic institutions.</p>

<p>Affinity purified Rabbit polyclonal PCCB antibody</p>

<p>Rabbit Polyclonal ZNF10 antibody</p>

<p>The p300 antibody is a highly specific and potent monoclonal antibody that is widely used in Life Sciences research. It has been extensively validated for its high specific activity and neutralizing capabilities. The p300 antibody binds to alpha-fetoprotein, interferon, annexin, and annexin A2 with exceptional affinity, making it an ideal tool for various assays and experiments. Researchers rely on the p300 antibody to study the role of these molecules in different biological processes. Additionally, this antibody has shown promising results in detecting superoxide levels and fatty acid metabolism. Whether you are studying protein-protein interactions or investigating cellular pathways, the p300 antibody is an indispensable tool for your research needs.</p>

<p>Trypsin antibody was raised in mouse using purified human pancreatic trypsin as the immunogen.</p>

<p>RCC2 antibody was raised using the middle region of RCC2 corresponding to a region with amino acids RIRSLACGKSSIIVAADESTISWGPSPTFGELGYGDHKPKSSTAAQEVKT</p>

<p>Rabbit polyclonal TCEAL7 antibody</p>

<p>GFRA4 antibody was raised in rabbit using the C terminal of GFRA4 as the immunogen</p>

<p>GNB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKAD</p>

<p>Rabbit Polyclonal ATP5L2 antibody</p>

<p>Purified Polyclonal PIP5K1C antibody</p>

<p>Mouse Tie2 immunogen, Rat monoclonal Tie2 antibody (biotin)</p>

<p>C4ORF22 antibody was raised using the N terminal Of C4Orf22 corresponding to a region with amino acids YLEDETLARQLVELGYRGTGERVKREDFEARKAAIEIARLAERAQQKTLT</p>

<p>The Osteopontin antibody is a glycoprotein that has cytotoxic effects and interferes with the function of serine protease inhibitors. It is a type of monoclonal antibody that specifically targets osteopontin, a protein involved in various biological processes. This antibody has been shown to neutralize the activity of osteopontin, inhibiting its function and potentially preventing its involvement in disease progression. The Osteopontin antibody is commonly used in life sciences research and has shown promising results in studies related to cancer, inflammation, and other pathological conditions. With its ability to target specific molecules, this antibody offers great potential for therapeutic applications in the future.</p>

<p>The CPVL antibody is a polyclonal antibody that is widely used in the field of life sciences. It specifically targets epidermal growth factor (EGF) and chemokine receptors, making it an essential tool for researchers studying these signaling pathways. In addition to its polyclonal form, monoclonal antibodies are also available for more specific applications.</p>

<p>NDUFV2 antibody was raised in Rabbit using Human NDUFV2 as the immunogen</p>

<p>Giardia lamblia antibody is a monoclonal antibody that specifically targets and activates the immune response against Giardia lamblia, a parasite that causes gastrointestinal infections. This antibody binds to specific proteins expressed by the parasite, such as alpha-fetoprotein and β-catenin, preventing their function and inhibiting the growth and survival of Giardia lamblia. The use of this antibody in Life Sciences research has provided valuable insights into the mechanisms of host-parasite interactions and has led to the development of potential antiviral therapies. The formulation of this antibody includes excipients and polymers that enhance stability and prolong its shelf life. It can be used in various laboratory techniques, including immunoassays, immunofluorescence, and Western blotting, for the detection and quantification of Giardia lamblia in clinical samples.</p>

<p>The Forssman antigen antibody is a powerful biomolecule used in Life Sciences research. It exhibits protease activity and plays a crucial role in various biological processes. This monoclonal antibody targets the Forssman antigen, a glycoconjugate that is activated in response to certain stimuli. The Forssman antigen antibody has been extensively studied for its ability to neutralize the effects of the Forssman antigen and inhibit its binding to other proteins and cells. It has also shown potential as a therapeutic agent for autoimmune disorders, as it can interfere with the production of autoantibodies. Additionally, this antibody has been found to modulate the activity of growth factors and interferons, further highlighting its versatility in molecular biology research. With high bioavailability and specificity, the Forssman antigen antibody is an essential tool for scientists studying protein isoforms and exploring new avenues in immunology and biotechnology.</p>

<p>The Gamma synuclein antibody is a monoclonal antibody used in Life Sciences research. It specifically targets gamma synuclein, a protein that plays a role in cellular processes related to reactive oxygen species and apoptosis. The antibody can be used for various applications, including immunohistochemistry and western blotting, to detect the presence of gamma synuclein in tissues and cells. Additionally, this antibody has been shown to have neuroprotective properties and may be useful in studying the effects of cytotoxic drugs on neuronal cells. Its high specificity and sensitivity make it an excellent tool for researchers studying the function and regulation of gamma synuclein.</p>

<p>Purified Polyclonal NRSN2 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycin class. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, which prevents transcription and replication. The effectiveness of this drug has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. Additionally, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, it binds specifically to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>EpCAM antibody was raised in mouse using HT-29 colon carcinoma cell line as the immunogen.</p>

<p>LTK antibody was raised in rabbit using the N terminal of LTK as the immunogen</p>

<p>Mouse monoclonal FAHD2A antibody</p>

<p>Purified Rabbit polyclonal M3KE5 antibody</p>

<p>MRPS10 antibody was raised in Rabbit using Human MRPS10 as the immunogen</p>

<p>SPSB2 antibody was raised in rabbit using the C terminal of SPSB2 as the immunogen</p>

<p>ERK1 antibody was raised in mouse using recombinant full length ERK1 protein as the immunogen.</p>

<p>Purified Rabbit polyclonal MARCH2 antibody</p>

<p>The eNOS antibody is a glycoprotein that is widely used in Life Sciences research. It is an essential tool for studying the expression and activity of endothelial nitric oxide synthase (eNOS), an enzyme involved in the production of nitric oxide. This monoclonal antibody specifically recognizes eNOS and can be used in various applications, including Western blotting, immunohistochemistry, and immunoassays.</p>

<p>Rabbit polyclonal FAP1 antibody</p>

<p>The ID4 antibody is a highly specialized product used in the field of Life Sciences. It is commonly employed in chromatographic techniques and immobilization processes. This antibody specifically targets angptl3, a growth factor protein involved in various biological processes such as collagen production and cell growth. The ID4 antibody is known for its neutralizing properties, effectively inhibiting the activity of angptl3 dimers.</p>

<p>KRT34 antibody was raised in Rabbit using Human KRT34 as the immunogen</p>

<p>Rabbit polyclonal FTL antibody</p>

<p>Mouse monoclonal IFI35 antibody</p>

<p>The Allophycocyanin antibody is a valuable tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to allophycocyanin, a fluorescent protein commonly used as a marker in biological research. This antibody is highly specific and sensitive, allowing for accurate detection and quantification of allophycocyanin in various samples.</p>

<p>NGFR antibody was raised in Rabbit using Human NGFR as the immunogen</p>

<p>Mouse monoclonal PIH1D2 antibody</p>

<p>BDNF antibody is a type of monoclonal antibody that has neutralizing properties. It is commonly used in the field of life sciences for research purposes. BDNF (brain-derived neurotrophic factor) is a growth factor that plays a crucial role in the development and maintenance of neurons. The BDNF antibody binds to BDNF, preventing its activity and thereby providing a means to study its function.</p>

<p>CYP20A1 antibody was raised in Rabbit using Human CYP20A1 as the immunogen</p>

<p>The FSCN1 antibody is a highly specialized monoclonal antibody that has been developed for various applications in biomedical research. This antibody specifically targets the human serum and can be used in a variety of assays, including electrode-based or chromatographic techniques.</p>

<p>The WDR13 antibody is a human antibody that targets estrogen receptors. It acts as a soluble inhibitor of estrogen, preventing its binding to the receptors and inhibiting its activity. In addition to its role in regulating estrogen signaling, the WDR13 antibody also inhibits the function of costimulatory molecules and other substances involved in various life sciences processes. This antibody has been shown to have an inhibitory effect on serum insulin levels and may be used in research or therapeutic applications related to hormone regulation. Furthermore, the WDR13 antibody can be utilized as an inhibitor of kinases or cell cycle inhibitors, making it a versatile tool for studying cellular processes and developing targeted therapies.</p>

<p>Rabbit polyclonal CDPK30 antibody</p>

<p>The ADORA2A antibody is a highly specialized antibody used in the field of Life Sciences. It is derived from adeno-associated virus and is specifically designed to target and bind to the ADORA2A receptor. This receptor plays a crucial role in various biological processes, including nuclear signaling and interleukin production.</p>

<p>Mouse monoclonal GPHN antibody</p>

<p>The GLUR2 antibody is a polyclonal antibody used in Life Sciences research. It is an inhibitor that targets the hydroxyl group of GLUR2, a receptor for glutamate. This antibody has been shown to have an inhibitory effect on the activity of GLUR2, making it a potential inhibitor for pharmaceutical preparations. The GLUR2 antibody binds to the hydroxyl group and prevents it from interacting with other molecules, such as hsp90 or rapamycin complex. By inhibiting the activity of GLUR2, this antibody may have therapeutic implications in various diseases and conditions related to glutamate signaling pathways.</p>

<p>Affinity purified Rabbit polyclonal AP1S2 antibody</p>

<p>The Insulin Receptor antibody is a powerful tool used in Life Sciences research. It is a polyclonal antibody that specifically targets the insulin receptor, a crucial protein involved in adipose tissue function, growth factor signaling, and cellular metabolism. This antibody has been extensively validated for its high specificity and neutralizing activity against the insulin receptor.</p>

<p>METTL1 antibody was raised using the middle region of METTL1 corresponding to a region with amino acids KGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDV</p>

<p>ATG4D antibody was raised in Rabbit using Human ATG4D as the immunogen</p>

<p>Mouse monoclonal KATNB1 antibody</p>

<p>MBIP antibody was raised in Rabbit using Human MBIP as the immunogen</p>

<p>PLEKHA4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LHSGLQMRRARSPDLFTPLSRPPSPLSLPRPRSAPARRPPAPSGDTAPPA</p>

<p>CYP2W1 antibody was raised in Rabbit using Human CYP2W1 as the immunogen</p>

<p>Rabbit Polyclonal BCL2L12 antibody</p>

<p>Mouse monoclonal Luteinizing Hormone beta antibody</p>

<p>Rabbit polyclonal MYF5 antibody</p>

<p>ARIH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ATEVLSGYLERDISQDSLQDIKQKVQDKYRYCESRRRVLLQHVHEGYEKD</p>

<p>AGBL5 antibody was raised using the C terminal of AGBL5 corresponding to a region with amino acids RGLSSTLNVGVNKKRGLRTPPKSHNGLPVSCSENTLSRARSFSTGTSAGG</p>

<p>Purified Rabbit polyclonal PR2 antibody</p>

<p>GSX1 antibody was raised in Rabbit using Human GSX1 as the immunogen</p>

<p>Rabbit polyclonal OTUB1 antibody (FITC)</p>

<p>Recombinant human TNF-α</p>

<p>C10ORF33 antibody was raised using the N terminal Of C10Orf33 corresponding to a region with amino acids MAASGRGLCKAVAASPFPAWRRDNTEARGGLKPEYDAVVIGAGHNGLVAA</p>

<p>GYG2 antibody was raised in Rabbit using Human GYG2 as the immunogen</p>

<p>FXYD5 antibody was raised using the N terminal of FXYD5 corresponding to a region with amino acids LQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDD</p>

<p>EXOC5 antibody was raised using the N terminal of EXOC5 corresponding to a region with amino acids ATKVCHLGDQLEGVNTPRQRAVEAQKLMKYFNEFLDGELKSDVFTNSEKI</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycin class. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. It has been extensively studied using advanced techniques like patch-clamp to determine its human activity. The metabolism of this drug involves various transformations such as hydrolysis, oxidation, reduction, and conjugation. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth. With its potent properties, this drug offers a promising solution for combating tuberculosis.</p>

<p>The AQP4 antibody is a glycoprotein that plays a crucial role in the regulation of water balance in the body. It is an essential component of the cell membrane and facilitates the movement of water molecules across cell membranes. The AQP4 antibody is widely used in life sciences research, particularly in studies related to water transport and homeostasis.</p>

<p>The BSG antibody is a highly specialized product in the field of Life Sciences. It is an antiviral monoclonal antibody that specifically targets and neutralizes the activated glycoprotein known as BSG (Basigin). This monoclonal antibody has been extensively studied and proven to have high affinity and specificity for BSG.</p>

<p>HSV1 gG antibody was raised in mouse using herpes simplex type 1 gG as the immunogen.</p>

<p>Rabbit polyclonal RPL17 antibody</p>

<p>Rabbit polyclonal COL4A2 antibody (FITC)</p>

<p>Mouse monoclonal IL1b antibody (biotin)</p>

<p>MCM4 antibody was raised using the middle region of MCM4 corresponding to a region with amino acids VYKTHIDVIHYRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYE</p>

<p>Rabbit polyclonal SMARCE1 antibody</p>

<p>AIM2 antibody is a cytotoxic monoclonal antibody that targets the AIM2 protein. The AIM2 protein is involved in the regulation of cell growth and proliferation, specifically in the interaction between hyaluronic acid and epidermal growth factor receptors. This antibody can be used in various life science applications, including research, diagnostics, and therapeutic development.</p>

<p>CD29 antibody was raised in mouse using recombinant human CD29 (34-141aa) purified from E. coli as the immunogen.</p>

<p>KCNJ15 antibody was raised in Rabbit using Human KCNJ15 as the immunogen</p>

<p>Rabbit polyclonal CYB5 antibody (FITC)</p>

<p>Rabbit polyclonal PRP31 antibody</p>

<p>Purified Polyclonal CDC23 antibody</p>

<p>Rabbit polyclonal KAD5 antibody</p>

<p>Mouse monoclonal RAB4AN antibody</p>

<p>Affinity purified Rabbit polyclonal GABPB1 antibody</p>

<p>Mouse monoclonal PSMD2 antibody</p>

<p>Rabbit polyclonal SLD5 antibody</p>

<p>MASTL antibody was raised in rabbit using the C terminal of MASTL as the immunogen</p>

<p>NCAPD2 antibody was raised in Rabbit using Human NCAPD2 as the immunogen</p>

<p>IL7 antibody was raised in mouse using highly pure recombinant human IL-7 as the immunogen.</p>

<p>NETO2 antibody was raised in Rabbit using Human NETO2 as the immunogen</p>

<p>Rabbit polyclonal FANCG antibody (Ser383)</p>

<p>Mouse monoclonal MHC Class I antibody (biotin)</p>

<p>The S100B antibody is an acidic monoclonal antibody that acts as an inhibitor of various proteins and enzymes. It has been shown to inhibit the activity of liver microsomes, oncostatin, and histone H3 in Life Sciences research. This antibody specifically targets the S100B antigen and has been found to modulate dopamine and tyrosine metabolism. Additionally, it has been shown to affect the expression of β-catenin and exhibit anti-glial fibrillary properties. The S100B antibody is a valuable tool in research and diagnostics for studying various cellular processes and pathways involving these proteins.</p>

<p>The PLK1 antibody is a monoclonal antibody that targets the amino-terminal region of PLK1, a protein involved in various cellular processes. This antibody is widely used in life sciences research to study the role of PLK1 in cell growth and division. It has been shown to inhibit the activity of PLK1, leading to reduced proliferation and increased apoptosis in cancer cells. Additionally, this antibody has been found to decrease microvessel density and inhibit angiogenesis, making it a potential therapeutic target for cancer treatment. The PLK1 antibody has high affinity and specificity for its target, ensuring accurate and reliable results in experiments. It can be used in various techniques such as immunohistochemistry, Western blotting, and flow cytometry. With its ability to neutralize PLK1 activity, this antibody holds great promise for advancing our understanding of cellular processes and developing novel therapeutic strategies.</p>

<p>GALK2 antibody was raised in Rabbit using Human GALK2 as the immunogen</p>