Anticuerpos primarios

<p>Rabbit polyclonal RPS11 antibody</p>

<p>DLX5 antibody was raised in Rabbit using Human DLX5 as the immunogen</p>

<p>Ceruloplasmin antibody is a highly specialized antibody used in Life Sciences research. It specifically targets ceruloplasmin, a protein involved in the regulation of copper concentrations in the body. This antibody is commonly used in studies related to cholinergic and dopamine pathways.</p>

<p>HOPX antibody was raised in Rabbit using Human HOPX as the immunogen</p>

<p>Purified Rabbit polyclonal TLP12 antibody</p>

<p>Rabbit polyclonal ALK antibody (Tyr1604)</p>

<p>The Anti-PGI antibody is a monoclonal antibody that targets and inhibits the growth factor PGI (Prostaglandin I2). It has been shown to reduce microvessel density in adipose tissue and inhibit the activity of fibronectin, a protein involved in cell adhesion and migration. This antibody also interacts with various other factors, including epidermal growth factor, E-cadherin, TGF-beta, oncostatin, and β-catenin. Its activation leads to the suppression of these factors, resulting in anti-inflammatory and anti-tumor effects. The Anti-PGI antibody is widely used in life sciences research for its ability to specifically target and neutralize PGI, making it an essential tool for studying the role of this growth factor in various biological processes.</p>

<p>The DHFR antibody is a monoclonal antibody that has inhibitory properties against dihydrofolate reductase (DHFR), an enzyme involved in the synthesis of DNA, RNA, and proteins. This antibody specifically binds to DHFR and prevents its activity, leading to cytotoxic effects on cells. It is commonly used in Life Sciences research for various applications, including Western blotting, immunohistochemistry, and flow cytometry. The DHFR antibody has been shown to inhibit the growth of cancer cells by targeting the β-catenin pathway and blocking the activation of epidermal growth factor receptors. Additionally, this antibody has been found to have creatine kinase inhibitory properties, which may be beneficial in certain disease conditions. With its high specificity and potency, the DHFR antibody is a valuable tool for studying cellular processes and developing targeted therapies.</p>

<p>Rabbit polyclonal SH3GL3 antibody</p>

<p>C20orf30 antibody was raised in Rabbit using Human C20orf30 as the immunogen</p>

<p>CUEDC2 antibody was raised in Rabbit using Human CUEDC2 as the immunogen</p>

<p>RTN4IP1 antibody was raised in rabbit using the middle region of RTN4IP1 as the immunogen</p>

<p>GSK3B antibody was raised in Rabbit using Human GSK3B as the immunogen</p>

<p>Mouse monoclonal MHC Class II antibody (allophycocyanin)</p>

<p>FABP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHG</p>

<p>TLR7 antibody is a polyclonal antibody that specifically targets Toll-like receptor 7 (TLR7). TLR7 is an important protein involved in the immune response and plays a crucial role in recognizing viral RNA. The TLR7 antibody can be used for various applications such as immunoassays, Western blotting, and immunohistochemistry.</p>

<p>MLPH antibody was raised in Rabbit using Human MLPH as the immunogen</p>

<p>Rabbit polyclonal Ezrin antibody (Tyr478)</p>

<p>The BIRC5 antibody is a potent family kinase inhibitor that belongs to the class of inhibitors used in Life Sciences. It targets the growth factor receptors and tyrosine kinases, inhibiting their activity and preventing cell proliferation. The BIRC5 antibody has been shown to have significant effects on breast cancer cells such as MCF-7, reducing their viability and inducing apoptosis. This monoclonal antibody has also been found to interact with other proteins such as annexin and fibrinogen, suggesting its potential role in various biological processes. Additionally, the BIRC5 antibody has been used as a research tool in neuroscience studies, specifically in investigating the role of dopamine receptors. With its high specificity and affinity, this antibody is an invaluable tool for researchers in understanding cellular signaling pathways and developing targeted therapies.</p>

<p>BLVRB antibody was raised using the middle region of BLVRB corresponding to a region with amino acids GLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTD</p>

<p>Mouse monoclonal PIM2 antibody</p>

<p>Purified Polyclonal NFE2L3 antibody</p>

<p>The S100A9 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and neutralize the activity of S100A9 protein, which is known to be involved in various cellular processes. This antibody has been extensively studied and proven to be effective in inhibiting the growth factor activity of S100A9. It can be used as a valuable tool in research studies focusing on androgen inhibitors, as well as in the development of therapeutics targeting this specific protein. The S100A9 antibody is available in both monoclonal and polyclonal forms, providing researchers with options for their specific experimental needs. With its high specificity and reliability, this antibody is an essential component in any study involving S100A9 protein.</p>

<p>Purified Polyclonal AASS antibody</p>

<p>Rabbit polyclonal RAB39 antibody</p>

<p>CLIC5 antibody was raised using the middle region of CLIC5 corresponding to a region with amino acids HPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFS</p>

<p>Mouse monoclonal CTLA4 antibody (HRP)</p>

<p>PRKAB2 antibody was raised using the middle region of PRKAB2 corresponding to a region with amino acids RDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPA</p>

<p>Mouse monoclonal N-acetyltransferase antibody</p>

<p>BEX2 antibody was raised in Rabbit using Human BEX2 as the immunogen</p>

<p>CKS2 antibody was raised in Rabbit using Human CKS2 as the immunogen</p>

<p>Mouse monoclonal NK1.1 antibody (PE)</p>

<p>Rabbit polyclonal LCN2 antibody (FITC)</p>

<p>Rat monoclonal BP1 antibody (biotin)</p>

<p>CD40 antibody is a powerful cytotoxic agent that targets the CD40 protein, which plays a crucial role in protein-protein interactions and is involved in various biological processes. This antibody can be either polyclonal or monoclonal, depending on its source. It has been extensively used in the field of Life Sciences for research purposes.</p>

<p>Rabbit polyclonal APEX1 antibody</p>

<p>IL17RE antibody was raised in Rabbit using Human IL17RE as the immunogen</p>

<p>The TRIM2 antibody is a monoclonal antibody that targets interferon-gamma (IFN-gamma), acetylcholine, and endothelial growth factor. It is specifically designed for use in Life Sciences research and has been proven to be highly effective in neutralizing the activity of these proteins. This antibody can be used in various applications such as immunoassays, immunohistochemistry, and flow cytometry. Its high specificity and affinity make it a valuable tool for studying the role of IFN-gamma, acetylcholine, and endothelial growth factor in various biological processes. Whether you are conducting basic research or developing therapeutic strategies, the TRIM2 antibody is an essential component of your experimental toolkit.</p>

<p>C14ORF130 antibody was raised using the middle region of C14Orf130 corresponding to a region with amino acids MIQCVVCEDWFHGRHLGAIPPESGDFQEMVCQACMKRCSFLWAYAAQLAV</p>

<p>Affinity purified Rabbit polyclonal SCY1 like 3 antibody</p>

<p>The Caspase 9 antibody is a highly specific monoclonal antibody that targets the nuclear enzyme caspase 9. It is widely used in the field of Life Sciences for research purposes. This antibody serves as an inhibitor of caspase 9, which plays a crucial role in apoptosis (programmed cell death). By binding to its antigen, caspase 9, this monoclonal antibody effectively blocks its activity and prevents cell death.</p>

<p>Rabbit polyclonal MRPS7 antibody</p>

<p>The FZD2 antibody is a powerful tool in the field of Life Sciences. It has been extensively studied and proven to be highly effective in various applications. This antibody is specifically designed to target and bind to the Frizzled-2 receptor, which plays a crucial role in cellular signaling pathways.</p>

<p>Rabbit polyclonal PSMB2 antibody (biotin)</p>

<p>Rabbit polyclonal UQCR antibody</p>

<p>The MIOX antibody is a highly specialized monoclonal antibody that has proven to be an invaluable tool in the field of life sciences. It is widely used in various research applications, including enzyme assays, immunoassays, and protein purification.</p>

<p>PAPPA antibody was raised in mouse using purified human PAPP-A/proMBP complex or purified human atherosclerotic tissue form of PAPP-A as the immunogen.</p>

<p>BAG5 antibody was raised in rabbit using the N terminal of BAG5 as the immunogen</p>

<p>The HSPA1A antibody is a monoclonal antibody that specifically targets the glycoprotein HSPA1A. This antibody has been shown to have multiple functions, including its ability to inhibit interferon and leukemia inhibitory factor signaling pathways. Additionally, it has been found to have antiphospholipid antibodies and antiviral activity. The HSPA1A antibody also acts as an inhibitor of dopamine release and exhibits cytotoxic effects on certain hormone peptides. Furthermore, it has been used as an anticoagulant in human serum and has been shown to target autoantibodies. With its diverse range of functions, the HSPA1A antibody holds great potential for various therapeutic applications.</p>

<p>Rabbit polyclonal PSMD14 antibody</p>

<p>PARP9 antibody was raised using a synthetic peptide corresponding to a region with amino acids LHGGGLALALVKAGGFEIQEESKQFVARYGKVSAGEIAVTGAGRLPCKQI</p>

<p>The Progesterone Receptor Antibody is a powerful tool for researchers in the field of Life Sciences. This antibody, available in both polyclonal and monoclonal forms, is specifically designed to detect and stain progesterone receptors in various tissues and cell types. It has been extensively tested and validated for use in immunohistochemistry applications.</p>

<p>Rabbit polyclonal JIP2 antibody</p>

<p>The PHB antibody is a polyclonal antibody used in Life Sciences research. It can be utilized in various applications such as immunohistochemistry, flow cytometry, and western blotting. This antibody specifically targets PHB (prohibitin), a protein involved in multiple cellular processes including cell proliferation, apoptosis, and mitochondrial function. The PHB antibody is commonly used to study the role of PHB in cancer development and progression. It has also been shown to have neutralizing activity against growth factors like epidermal growth factor and chemokines. Additionally, this antibody has been used in combination with other antibodies such as cetuximab to enhance their therapeutic effects. With its high specificity and reliability, the PHB antibody is an essential tool for researchers studying various biological processes related to PHB and its associated pathways.</p>

<p>The PMVK antibody is a highly specialized product in the field of Life Sciences. It is a polyclonal antibody that targets octanoyltransferase, an enzyme involved in the biosynthesis of coenzyme A. This antibody can be used as a serum marker for the detection and quantification of octanoyltransferase levels in biological samples. Octanoyltransferase plays a crucial role in the cation channel-mediated transport of carnitine, which is essential for fatty acid metabolism. By detecting and measuring octanoyltransferase levels, this antibody can aid in the development of new medicaments and inhibitors targeting this enzyme. Additionally, monoclonal antibodies against PMVK have shown potential antiviral activity by inhibiting interleukin production and blocking autoantibodies. The PMVK antibody is a valuable biomarker composition that can contribute to various research fields within Life Sciences.</p>

<p>Rabbit polyclonal KDM3A antibody</p>

<p>The RGS16 antibody is a highly specialized growth factor that plays a crucial role in various biological processes. It interacts with the apical membrane of cells and facilitates the binding of antibodies to specific targets. This antibody is particularly effective in recognizing and binding to human folate, which is essential for healthy cell growth and development. Additionally, the RGS16 antibody has been found to be involved in glycosylation processes, promoting proper protein structure and function.</p>

<p>Rabbit polyclonal 4EBP1 antibody (Thr69)</p>

<p>Rabbit polyclonal ZNF703 antibody</p>

<p>The HDAC6 antibody is a highly specialized antibody used in the field of Life Sciences. It is commonly used for research purposes, particularly in studies involving mesenchymal stem cells and their differentiation. This antibody is designed to specifically target and neutralize HDAC6, an enzyme involved in the regulation of gene expression.</p>

<p>The STARD10 antibody is a monoclonal antibody that specifically targets the glycan structures on STARD10 protein. It plays a crucial role in glycosylation, which is the process of adding carbohydrate molecules to proteins. By binding to the glycan structures, this antibody can modulate the activity of STARD10 and its downstream signaling pathways.</p>

<p>The CD8b antibody is a neutralizing antibody that is widely used in Life Sciences research. It specifically targets the CD8b protein, which plays a crucial role in immune responses. This antibody has been extensively studied and shown to have various effects on different biological processes.</p>

<p>DDX39 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAEQDVENDLLDYDEEEEPQAPQESTPAPPKKDIKGSYVSIHSSGFRDFL</p>

<p>RARS antibody is a monoclonal antibody that specifically targets the tyrosine kinase receptor, inhibiting endothelial cell proliferation. This antibody has neutralizing properties and is widely used in Life Sciences research to study endothelial growth and collagen synthesis. Additionally, RARS antibody can be used as an inhibitor of growth hormone receptor activity, blocking the binding of growth factors and preventing downstream signaling pathways. Polyclonal Antibodies against RARS are also available, providing a broader range of target specificity. These antibodies have been extensively studied for their role in autoimmune diseases, where autoantibodies against RARS have been identified.</p>

<p>The GAD67 antibody is a highly reactive monoclonal antibody that is widely used in Life Sciences research. It specifically binds to the 3-kinase domain of glutamate decarboxylase 67 (GAD67), an enzyme involved in the synthesis of the neurotransmitter gamma-aminobutyric acid (GABA). This antibody has been extensively validated for various applications, including immunohistochemistry, immunofluorescence, and Western blotting.</p>

<p>The BCL2 antibody is a highly specialized polyclonal antibody that is used in life sciences research. It is commonly used for immunohistochemistry studies to detect the presence of BCL2 antigen in various tissues. This antibody specifically targets the BCL2 protein, which plays a crucial role in regulating cell survival and apoptosis.</p>

<p>Purified Polyclonal PRIM1 antibody</p>

<p>Rabbit polyclonal ADA2L antibody</p>

<p>Affinity purified Rabbit polyclonal ET3 antibody</p>

<p>DDX24 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELRHLLSQPLFTESQKTKYPTQSGKPPLLVSAPSKSESALSCLSKQKKKK</p>

<p>Rabbit polyclonal GCN5L2 antibody</p>

<p>RMND1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEKHEIQPYEIALVHWENEELNYIKIEGQSKLHRGEIKLNSELDLDDAIL</p>

<p>Myc antibody is a highly specific and sensitive tool used in Life Sciences for various applications. This polyclonal antibody recognizes the β-catenin protein, specifically targeting its acid residues. It plays a crucial role in protein-protein interactions and is widely used in research to study cellular processes and signaling pathways involving β-catenin.</p>

<p>Plasmodium vivax antibody is a Monoclonal Antibody that specifically targets the adeno-associated virus (AAV) oncogene homolog in Plasmodium vivax. It has been developed for use in bioassays and research in the Life Sciences field. This antibody binds to the target molecule, inhibiting its activity and preventing the growth and replication of Plasmodium vivax. The antibody complex formed by Plasmodium vivax antibody has shown efficacy in inhibiting caspase-9, an enzyme involved in apoptosis, and reducing steroid levels in human serum. Additionally, this antibody has potential applications in targeting other parasitic organisms such as Cryptosporidium. With its high specificity and potent inhibitory effects, Plasmodium vivax antibody is a valuable tool for researchers studying parasitic infections and developing new therapeutic strategies.</p>

<p>Mouse monoclonal PLEK antibody</p>

<p>The ACAT1 antibody is a colloidal antibody that is used in various life science applications. It specifically targets and binds to the ACAT1 protein, which is involved in cholesterol metabolism and lipid storage. This antibody can be used for research purposes, such as studying the role of ACAT1 in cellular processes or as a diagnostic tool for detecting the presence of ACAT1 in biological samples. The ACAT1 antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options based on their specific needs. It has been validated for use in various assays, including immunofluorescence (IF), immunohistochemistry (IHC), western blotting (WB), and enzyme-linked immunosorbent assay (ELISA). With its high specificity and sensitivity, the ACAT1 antibody is a valuable tool for investigating the function and regulation of ACAT1 in different biological systems.</p>

<p>The Lck antibody is a powerful cytotoxic agent that targets TGF-β1, a protein involved in cell growth and differentiation. It is a polyclonal antibody that can be used in various life science applications. The Lck antibody has been shown to inhibit the activity of GM-CSF (colony-stimulating factor) and other growth factors, making it an effective tool for studying cell signaling pathways. Additionally, this antibody can be used as a monoclonal antibody to specifically target and neutralize Lck, a tyrosine kinase involved in T-cell activation. Its specificity towards Lck makes it an invaluable tool for researchers studying immune responses and related diseases.</p>

<p>Rabbit polyclonal PDK1 antibody (Tyr9)</p>

<p>Rabbit polyclonal TEKT2 antibody</p>

<p>Rabbit polyclonal TICAM2 antibody</p>

<p>The ATF2 antibody is a high-quality polyclonal antibody that specifically targets and neutralizes the activity of ATF2, a protein involved in various cellular processes. This antibody has been extensively tested and validated for its specificity and efficacy. It binds to ATF2 with high affinity, inhibiting its function and preventing its interaction with other proteins.</p>

<p>The FAM84B antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets FAM84B, an important protein involved in various biological processes. This antibody has been extensively studied and validated for its efficacy and specificity.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its effectiveness has been proven through extensive testing using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Purified Polyclonal IKK alpha antibody</p>

<p>HIST1H1E antibody was raised using the N terminal of HIST1H1E corresponding to a region with amino acids MSETAPAAPAAPAPAEKTPVKKKARKSAGAAKRKASGPPVSELITKAVAA</p>

<p>Rabbit polyclonal OR2AP1 antibody</p>

<p>HMGB2 antibody was raised in Rabbit using Human HMGB2 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal Kininogen 1 antibody</p>

<p>Rabbit polyclonal PE2R2 antibody</p>

<p>Affinity purified Rabbit polyclonal DENND1B antibody</p>

<p>Rabbit polyclonal CASR antibody (Thr888)</p>

<p>PRKCZ antibody was raised using the N terminal of PRKCZ corresponding to a region with amino acids MDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKP</p>

<p>Rabbit polyclonal Lpa12 antibody</p>

<p>C6ORF201 antibody was raised using the N terminal Of C6Orf201 corresponding to a region with amino acids PFGMGLGNTSRSTDAPSQSTGDRKTGSVGSWGAARGPSGTDTVSGQSNSG</p>

<p>MED12 antibody was raised in Rabbit using Human MED12 as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity and is highly effective in treating tuberculosis infections. This active compound works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, which prevents transcription and replication. Studies have shown its high frequency of human activity using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Rifapentine also specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Purified Rabbit polyclonal ZNF816A antibody</p>

<p>Rabbit polyclonal REEP6 antibody</p>

<p>Lamin B2 antibody was raised using the N terminal of LMNB2 corresponding to a region with amino acids MATPLPGRAGGPATPLSPTRLSRLQEKEELRELNDRLAHYIDRVRALELE</p>

<p>Affinity purified Rabbit polyclonal hnRNP C1/C2 antibody</p>