Anticuerpos primarios

<p>MMP9 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The PRL-3 antibody is a specific antibody used in Life Sciences research. It is commonly used as a serum marker to detect the presence of PRL-3 protein, which is associated with various diseases and conditions. This antibody has been extensively studied and proven to be highly effective in detecting PRL-3 protein in samples. It can be used in various applications such as ELISA, Western blotting, immunohistochemistry, and flow cytometry. The PRL-3 antibody is an essential tool for researchers working on interferon signaling pathways, pluripotent stem cell differentiation, fetal hemoglobin regulation, and other related areas. Its high specificity and sensitivity make it an ideal choice for accurate detection and quantification of PRL-3 protein levels in biological samples.</p>

<p>The Cathepsin D antibody is a polyclonal antibody that specifically targets and neutralizes the activity of Cathepsin D. This enzyme plays a crucial role in various cellular processes, including growth factor receptor binding, phosphatase activity, and adipose tissue development. The Cathepsin D antibody is derived from human serum and has been extensively tested for its efficacy in various experimental settings.</p>

<p>CD81 antibody (biotin) was raised in hamster using murine epithelial cell line PAM212 as the immunogen.</p>

<p>HSV1/HSV2 antibody was raised in mouse using HSV 1 and 2 as the immunogen.</p>

<p>CD20 antibody (Spectral Red) was raised in mouse using human CD20 as the immunogen.</p>

<p>CD40 antibody (Spectral Red) was raised in rat using CD40 as the immunogen</p>

<p>CD3 antibody (Allophycocyanin) was raised in mouse using the epsilon chain of CD3/T-cell antigen receptor complex as the immunogen.</p>

<p>CD8a antibody was raised in mouse using porcine CD8a as the immunogen.</p>

<p>CD44 antibody (Spectral Red) was raised in mouse using chicken CD44 as the immunogen.</p>

<p>CD21 antibody (biotin) was raised in mouse using porcine CD21 as the immunogen.</p>

<p>CD19 antibody (FITC) was raised in rat using murine CD19-expressing K562 human erythroleukemia cells as the immunogen.</p>

<p>CD86 antibody (FITC) was raised in rat using LPS-activated murine B cells as the immunogen.</p>

<p>CD3e antibody (Spectral Red) was raised in mouse using porcine CD3e as the immunogen.</p>

<p>CD117 antibody (biotin) was raised in rat using murine CD117/c-Kit as the immunogen.</p>

<p>CD103 antibody (Azide free) was raised in hamster using murine CD103 as the immunogen.</p>

<p>The ApoER2 antibody is a highly specific reagent used in Life Sciences research. It is produced by a hybridoma cell line and targets the ApoER2 molecule. This monoclonal antibody has been extensively tested and validated for its reactivity against dopamine, endogenous protein kinase, inhibitor p21, IL-2 receptor, and other relevant targets.</p>

<p>CD8b antibody (PE) was raised in Mouse using the beta chain of chicken CD8 as the immunogen.</p>

<p>CD16 antibody (biotin) was raised in rat using murine CD16/32 (CD16/Fc gamma II and CD32/Fc gamma III receptors)</p>

<p>Mouse monoclonal CD49d antibody (FITC)</p>

<p>CD81 antibody (PE) was raised in hamster using murine epithelial cell line PAM212 as the immunogen.</p>

<p>CD11a antibody (PE-CY7) was raised in rat using murine CD11a (LFA-1a) as the immunogen.</p>

<p>CD86 antibody (PE-CY7) was raised in rat using murine CD86 as the immunoge.</p>

<p>Mouse monoclonal CD55 antibody</p>

<p>CD22 antibody (PE) was raised in rat using CD22 as the immunogen.</p>

<p>CD49b antibody (Allophycocyanin) was raised in rat using RIL-2-propagated NK1.1+ cells from C57BL/6 mice as the immunogen.</p>

<p>CD106 antibody (FITC) was raised in mouse using human endothelial cells as the immunogen.</p>

<p>CD19 antibody (Allophycocyanin) was raised in rat using murine CD19-expressing K562 human erythroleukemia cells as the immunogen.</p>

<p>CD122 antibody (FITC) was raised in rat using rat myeloma YB2/0 transfected with truncated murine IL-2RB cDNA as the immunogen.</p>

<p>CD45.2 antibody (PE-CY7) was raised in mouse using CD45.2 as the immunogen.</p>

<p>CD3e antibody (PE) was raised in hamster using H-2Kb-specific mouse cytotoxic T lymphocyte as the immunogen.</p>

<p>Streptococcus group A antibody (biotin) was raised in rabbit using group A Streptococci as the immunogen.</p>

<p>CD147 antibody (biotin) was raised in mouse using human T cell line Molt 13 as the immunogen.</p>

<p>CD23 antibody (PE-CY7) was raised in rat using CD23 low affinity IgE Fc receptor as the immunogen.</p>

<p>CD28 antibody (PE) was raised in hamster using CD28 costimulatory receptor as the immunogen.</p>

<p>CD11b antibody (biotin) was raised in rat using peritoneal macrophages from C57 B1/6 x DBA/2 F1 hybrid mice as the immunogen.</p>

<p>CD45.1 antibody (CY5) was raised in mouse using CD45.1 as the immunogen.</p>

<p>CD11a antibody (FITC) was raised in mouse using human CD11a (LFA-1a) as the immunogen.</p>

<p>CD5 antibody (FITC) was raised in rat using CD5/Lyt-1 as the immunogen.</p>

<p>CD11b antibody (FITC) was raised in rat using peritoneal macrophages from C57 B1/6 x DBA/2 F1 hybrid mice as the immunogen.</p>

<p>CD45.1 antibody (PE-CY7) was raised in mouse using CD45.1 as the immunogen.</p>

<p>CD90 antibody (Spectral Red) was raised in rat using murine T-Cell hybridoma c6/G8, produced by fusion of porl insulin-specific BALB/c T cells with the AKR thymoma line BW 5147 as the immunogen.</p>

<p>CD16 antibody (PE) was raised in rat using murine CD16/32 (CD16/Fc gamma II and CD32/Fc gamma III receptors)</p>

<p>CD106 antibody (PE) was raised in Mouse using human CD106/VCAM-1 as the immunogen.</p>

<p>CD80 antibody (Allophycocyanin) was raised in rat using CD80/B7-1 as the immunogen.</p>

<p>Influenza A antibody (FITC) was raised in mouse using Influenza A nucleoprotein as the immunogen.</p>

<p>CD20 antibody (PE) was raised in mouse using human CD20 as the immunogen.</p>

<p>CD45.2 antibody (PE) was raised in mouse using CD45.2 as the immunogen.</p>

<p>CD117 antibody (Allophycocyanin) was raised in rat using murine CD117/c-Kit as the immunogen.</p>

<p>CD3e antibody (FITC) was raised in mouse using porcine CD3e as the immunogen.</p>

<p>CD45 antibody (Allophycocyanin) was raised in Rat using CD45/LCA as the immunogen.</p>

<p>CD8a antibody (Allophycocyanin) was raised in rat using murine thymus or spleen as the immunogen.</p>

<p>CD38 antibody (PE) was raised in rat using CD38 as the immunogen.</p>

<p>CD90.2 antibody (Allophycocyanin) was raised in rat using CD90.2/`Thy-1.2 alloantigen as the immunogen.</p>

<p>CD44 antibody (Allophycocyanin) was raised in rat using murine CD44 as the immunogen.</p>

<p>CD25 antibody (PE-CY7) was raised in rat using alpha chain IL-2 receptor as the immunogen.</p>

<p>CD3e antibody (Allophycocyanin) was raised in rat using CD3e as the immunogen.</p>

<p>CD122 antibody (Azide free) was raised in rat using rat myeloma YB2/0 transfected with truncated murine IL-2RB cDNA as the immunogen.</p>

<p>Sik1 antibody was raised in rabbit using the middle region of Sik1 as the immunogen</p>

<p>FAM134A antibody was raised using the N terminal of FAM134A corresponding to a region with amino acids AGSGARPHLLSVPELCRYLAESWLTFQIHLQELLQYKRQNPAQFCVRVCS</p>

<p>GLUT8 antibody was raised in rabbit using an 11 amino acid peptide from mouse Glut-6 as the immunogen.</p>

<p>KLK-L2 antibody was raised in rabbit using residues 280-293 [KFTKWIQETIQANS] of the human KLK-L2 protein as the immunogen.</p>

<p>CMTM8 antibody was raised using the middle region of CMTM8 corresponding to a region with amino acids CFNGSAFVLYLSAAVVDASSVSPERDSHNFNSWAASSFFAFLVTICYAGN</p>

<p>OXCT1 antibody was raised using the N terminal of OXCT1 corresponding to a region with amino acids TLAERIRAGGAGVPAFYTPTGYGTLVQEGGSPIKYNKDGSVAIASKPREV</p>

<p>BTBD12 antibody was raised in rabbit using the N terminal of BTBD12 as the immunogen</p>

<p>The ABL1 antibody is a mouse monoclonal antibody used in Life Sciences research. It specifically targets the antigen binding domain of the ABL1 protein, which is a human protein involved in various cellular processes. This monoclonal antibody can be used for cytometry analysis to detect and quantify the presence of ABL1 in cells.</p>

<p>MIA2 antibody was raised in rabbit using human highly pure recombinant human MIA-2 as the immunogen.</p>

<p>ADAMDEC1 antibody was raised using the middle region of ADAMDEC1 corresponding to a region with amino acids GMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCL</p>

<p>Collagen Type IV alpha 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPVERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDETEYGCRGSICL</p>

<p>SHANK1a antibody was raised in rabbit using residues [ERLLREYPQSFEKGV] of the N terminus of the Shank1a protein as the immunogen.</p>

<p>PTGER3 antibody was raised using a synthetic peptide corresponding to a region with amino acids ILDPWVYLLLRKILLRKFCQIRYHTNNYASSSTSLPCQCSSTLMWSDHLE</p>

<p>CHIC2 antibody was raised using the N terminal of CHIC2 corresponding to a region with amino acids EEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASI</p>

<p>SPOP antibody was raised in rabbit using the C terminal of SPOP as the immunogen</p>

<p>SSX8 antibody was raised in rabbit using the C terminal of SSX8 as the immunogen</p>

<p>TM9SF1 antibody was raised in rabbit using the C terminal of TM9SF1 as the immunogen</p>

<p>G3BP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RFMQTFVLAPEGSVANKFYVHNDIFRYQDEVFGGFVTEPQEESEEEVEEP</p>

<p>TMEM149 antibody was raised using the N terminal of TMEM149 corresponding to a region with amino acids WRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWP</p>

<p>The ADRB3 antibody is a highly specialized antibody used in the field of Life Sciences. It is a polyclonal antibody that targets the adrenergic receptor beta-3 (ADRB3), which plays a crucial role in various physiological processes such as adipose tissue metabolism and regulation of energy expenditure. This antibody has been extensively studied and proven to have neutralizing properties against ADRB3, making it an essential tool for researchers studying growth factors, alpha-fetoprotein, and other related molecules.</p>

<p>GAA antibody was raised using the N terminal of GAA corresponding to a region with amino acids FGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPL</p>

<p>ST6GALNAC6 antibody was raised using the C terminal of ST6GALNAC6 corresponding to a region with amino acids YHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHP</p>

<p>IMPAD1 antibody was raised using the N terminal of IMPAD1 corresponding to a region with amino acids VLAAVRGGDEVRRVRESNVLHEKSKGKTREGAEDKMTSGDVLSNRKMFYL</p>

<p>PLA1A antibody was raised using the middle region of PLA1A corresponding to a region with amino acids TDTDNLGIRIPVGHVDYFVNGGQDQPGCPTFFYAGYSYLICDHMRAVHLY</p>

<p>GLP2R antibody was raised using the N terminal of GLP2R corresponding to a region with amino acids KLGSSRAGPGRGSAGLLPGVHELPMGIPAPWGTSPLSFHRKCSLWAPGRP</p>

<p>CAPN11 antibody was raised in rabbit using the N terminal of CAPN11 as the immunogen</p>

<p>MMP20 antibody was raised using the middle region of MMP20 corresponding to a region with amino acids AAVYLREPQKTLFFVGDEYYSYDERKRKMEKDYPKNTEEEFSGVNGQIDA</p>

<p>Purified Polyclonal Adenosine Kinase antibody</p>

<p>MUCP3 antibody was raised in rabbit using a sythentic peptide C R(295) A L M K V Q V L R E S P F(308) corresponding to residues 295-308 of the mouse and rat UCP-3 protein as the immunogen.</p>

<p>KIAA0152 antibody was raised in rabbit using the C terminal of KIAA0152 as the immunogen</p>

<p>TMEM118 antibody was raised using the N terminal Of Tmem118 corresponding to a region with amino acids HGGHRGGSLLQHVGGDHRGHSEEGGDEQPGTPAPALSELKAVICWLQKGL</p>

<p>SLC8A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFIIIGICVYVIPDGE</p>

<p>SGCB antibody was raised using a synthetic peptide corresponding to a region with amino acids FSTDYETHEFHLPSGVKSLNVQKASTERITSNATSDLNIKVDGRAIVRGN</p>

<p>GLUT1 antibody was raised in rabbit using a 15 amino acid peptide of human Glut-1 protein as the immunogen.</p>

<p>CBX3 antibody was raised in rabbit using the middle region of CBX3 as the immunogen</p>

<p>Arpp21 antibody was raised in rabbit using the N terminal of Arpp21 as the immunogen</p>

<p>TIE1 antibody was raised in rabbit using a 20 amino acid peptide of human TIE1 as the immunogen.</p>

<p>CHST13 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALGSSWLGGEKRSPLQKLYDLDQDPRSTLAKVHRQRRDLLNSACSRHSRR</p>

<p>CD200R1 antibody was raised in rabbit using the N terminal of CD200R1 as the immunogen</p>

<p>POFUT2 antibody was raised using the N terminal of POFUT2 corresponding to a region with amino acids GAASRRRYLLYDVNPPEGFNLRRDVYIRIASLLKTLLKTEEWVLVLPPWG</p>

<p>GPCR5A antibody was raised using the C terminal Of Gpcr5A corresponding to a region with amino acids SQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDY</p>

<p>GABRB1 antibody was raised in rabbit using the middle region of GABRB1 as the immunogen</p>