Anticuerpos primarios

<p>ANKRD47 antibody was raised using the N terminal Of Ankrd47 corresponding to a region with amino acids GPAQLQLVREQMAAALRRLRELEDQARTLPELQEQVRALRAEKARLLAGR</p>

<p>The WDFY3 antibody is a highly valuable product in the field of Life Sciences. It is a Polyclonal Antibody that plays a crucial role as a biomarker composition. This antibody specifically targets cation channels and interleukins, making it an essential tool for researchers studying these areas.</p>

<p>Mouse monoclonal NRBP1 antibody</p>

<p>The BID antibody is a growth factor that belongs to the class of monoclonal antibodies. It targets specific chemokines and has been extensively studied in the field of Life Sciences. The BID antibody has shown great potential in various applications, including lysis assays, glycosylation studies, and as a tool for detecting specific proteins in research experiments. This monoclonal antibody has been used to study the role of epidermal growth factor (EGF) signaling pathway and its interaction with β-catenin and caspase-9. Additionally, it has been used as a diagnostic tool for detecting anti-dnp antibodies and as a therapeutic agent in the treatment of HER2-positive breast cancer alongside trastuzumab. With its high specificity and versatility, the BID antibody is an invaluable tool for researchers in various fields.</p>

<p>The BMP2 antibody is a highly specialized product in the field of Life Sciences. It is designed to target and inhibit the activity of bone morphogenetic protein 2 (BMP2), a key regulator of various cellular processes. This antibody specifically binds to activated BMP2, preventing its interaction with cellular receptors and downstream signaling pathways.</p>

<p>Rabbit polyclonal FOXN4 antibody</p>

<p>Rabbit polyclonal UBA7 antibody</p>

<p>PANK4 antibody was raised using the middle region of PANK4 corresponding to a region with amino acids LGAIGAFLKGAEQDNPNQYSWGENYAGSSGLMSASPELGPAQRARSGTFD</p>

<p>Rabbit polyclonal OR9A2 antibody</p>

<p>The CLPP antibody is a monoclonal antibody that targets collagen, a crucial component in the growth and development of various tissues. This antibody has been extensively studied for its potential therapeutic applications in promoting the growth and differentiation of mesenchymal stem cells. It works by binding to specific receptors on the surface of these cells, triggering a series of signaling events that promote cell proliferation and tissue regeneration.</p>

<p>Purified Polyclonal CK1 gamma 3 antibody</p>

<p>Mouse monoclonal LIPG antibody</p>

<p>Rabbit polyclonal ARHGDIA antibody</p>

<p>The LOX antibody is a reactive monoclonal antibody that is activated through chromatographic techniques. It is specifically designed to target and bind to LOX, a chemokine involved in various cellular processes. This antibody has been extensively used in research studies, such as Western blotting and immunohistochemistry, to detect the presence and localization of LOX in different tissues and cell types. Additionally, the LOX antibody has shown promising results in multidrug resistance studies, particularly in cardiomyocytes where it inhibits the efflux of anticancer drugs. Furthermore, this monoclonal antibody has demonstrated its potential therapeutic applications in regulating glucagon secretion and modulating polyunsaturated fatty acid metabolism. With its high specificity and affinity, the LOX antibody is an invaluable tool for researchers in the life sciences field.</p>

<p>NEIL2 antibody was raised in mouse using recombinant Human Nei Like 2 (E. Coli)</p>

<p>Mouse monoclonal GSTO2 antibody</p>

<p>Purified Rabbit polyclonal OSBPL10 antibody</p>

<p>Rabbit polyclonal TNNC1 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug from the class of rifamycins. It is highly effective in treating tuberculosis infections as it exhibits strong bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. Extensive research has been conducted on its human activity using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>The C1S antibody is a potent monoclonal antibody that belongs to the class of neutralizing antibodies. It is widely used in the field of Life Sciences for various applications. This antibody specifically targets and neutralizes C1S, a protease involved in the complement system. By inhibiting C1S activity, this antibody can modulate immune responses and prevent excessive inflammation. Additionally, this monoclonal antibody has been shown to have mitogenic properties, stimulating cell growth and proliferation in various cell types such as dopamine-producing cells and collagen-producing cells. Furthermore, it has been used in research studies to enhance the oncolytic activity of adenoviruses and inhibit protease activity at low pH levels. The C1S antibody is a valuable tool for researchers studying hepatocyte growth and activation pathways.</p>

<p>Rat monoclonal CCR7 antibody (PE)</p>

<p>Mouse monoclonal Ly49G antibody (PE)</p>

<p>HMHA1 antibody was raised in Rabbit using Human HMHA1 as the immunogen</p>

<p>FAM45B antibody was raised using the middle region of FAM45B corresponding to a region with amino acids AEDPEKSESQVIQDIALKTREIFTNLAPFSEVSADGEKRVLNLEALKQKR</p>

<p>Mouse monoclonal SH3GL1 antibody</p>

<p>AK5 antibody was raised using the N terminal of AK5 corresponding to a region with amino acids ESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQSLKIAERY</p>

<p>Purified Polyclonal MTND3 antibody</p>

<p>Rabbit polyclonal OR5AP2 antibody</p>

<p>CBX1 antibody was raised in Rabbit using Human CBX1 as the immunogen</p>

<p>Rabbit polyclonal STT3A antibody</p>

<p>The CD20 antibody is a glycoprotein that belongs to the family of polyclonal antibodies. It is commonly used in Life Sciences for various applications, including research and diagnostics. The CD20 antibody specifically targets the CD20 antigen, which is expressed on the surface of certain cells, such as B-cells and some types of cancer cells.</p>

<p>The VANGL1 antibody is a highly specialized monoclonal antibody that targets the VANGL1 protein. This protein is primarily found in the apical membrane of cells and plays a crucial role in various biological processes. The VANGL1 antibody has been extensively studied in the field of Life Sciences and has shown promising results in research related to epidermal growth factor signaling, tyrosine phosphorylation, human folate transport, collagen synthesis, and anti-CD20 therapy.</p>

<p>MANBAL antibody was raised in Rabbit using Human MANBAL as the immunogen</p>

<p>Rabbit polyclonal Retinoblastoma antibody (Thr826)</p>

<p>Mouse monoclonal TASP1 antibody</p>

<p>Rabbit Polyclonal PAK1/2/3 antibody</p>

<p>The PCNA antibody is a highly specific monoclonal antibody that targets the proliferating cell nuclear antigen (PCNA). It is commonly used in research and diagnostic applications to detect and quantify PCNA expression levels. PCNA plays a crucial role in DNA replication and repair, making it an important marker for cell proliferation and DNA synthesis. The PCNA antibody can be used to study various biological processes such as cell cycle progression, tumor growth, and response to DNA damage. With its high specificity and sensitivity, this antibody provides reliable results for researchers in the field of life sciences. Whether you are studying cellular pathways or investigating disease mechanisms, the PCNA antibody is an essential tool for your research.</p>

<p>ZNF294 antibody was raised using the N terminal of ZNF294 corresponding to a region with amino acids MGGKNKQRTKGNLRPSNSGRAAELLAKEQGTVPGFIGFGTSQSDLGYVPA</p>

<p>NHEDC1 antibody was raised using the N terminal of NHEDC1 corresponding to a region with amino acids MHTTESKNEHLEDENFQTSTTPQSLIDPNNTAHEETKTVLSDTEEIKPQT</p>

<p>The POR antibody is a monoclonal antibody that targets the growth factor POR (Peroxidase). This antibody is used for immobilization studies and can be activated by chemical agents. It specifically binds to the cation channel and glycoprotein POR, allowing for easy detection and analysis. The POR antibody has been extensively tested in Life Sciences research and has shown high specificity and sensitivity. It can be used in various applications such as Western blotting, ELISA, immunohistochemistry, and flow cytometry. Additionally, this monoclonal antibody has been proven effective in studying arginase and lipoprotein lipase. Trust the POR antibody for reliable results in your research experiments.</p>

<p>Mouse monoclonal GSTT2 antibody</p>

<p>Mouse monoclonal NPTN antibody</p>

<p>The RB antibody is a highly specialized monoclonal antibody that has been developed for ultrasensitive detection in the field of Life Sciences. This antibody exhibits high affinity and specificity towards its target molecule, making it ideal for immunoassays and other research applications.</p>

<p>Rabbit polyclonal RB antibody (Thr821)</p>

<p>HCFC2 antibody was raised in mouse using recombinant Human Host Cell Factor C2</p>

<p>The SRY antibody is a biomolecule that specifically targets the sex-determining region Y (SRY) protein. It is commonly used in research involving mesenchymal stem cells and brain natriuretic peptide. This antibody is buffered to ensure stability and effectiveness in various experimental conditions. The SRY antibody is available as both polyclonal antibodies and monoclonal antibodies, providing researchers with different options depending on their specific needs. It can be used as a standalone reagent or as part of a conjugate compound for enhanced detection and analysis. With its cytotoxic and growth factor properties, the SRY antibody plays a crucial role in various life sciences applications.</p>

<p>The FOXB2 antibody is a highly specialized antibody that targets specific proteins and markers in various biological processes. This antibody specifically binds to osteopontin, E-cadherin, amyloid plaque, oncostatin, glutamate, serum albumin protein, and β-catenin. It is widely used in the field of life sciences for research purposes.</p>

<p>PSA antibody was raised in mouse using highly pure human Free PSA as the immunogen.</p>

<p>The SERPINA3 antibody is a monoclonal antibody that targets the SERPINA3 protein. This protein plays a crucial role in various biological processes, including the regulation of lipoprotein metabolism and mineralocorticoid receptor activity. The antibody specifically binds to the SERPINA3 protein, forming a protein complex that inhibits its function.</p>

<p>Rabbit polyclonal C1QBP antibody</p>

<p>Mouse monoclonal SARS Nucleocapsid antibody</p>

<p>The ULBP2 antibody is a monoclonal antibody that acts as a growth factor and anti-VEGF (vascular endothelial growth factor). It belongs to the family of natriuretic globulin antibodies, which are binding proteins that regulate blood pressure and fluid balance. This antibody specifically targets ULBP2, a protein that plays a role in immune response regulation. By binding to ULBP2, the antibody can modulate the activity of immune cells and influence various physiological processes. The ULBP2 antibody can also be used in research and diagnostic applications in the field of Life Sciences. With its high specificity and affinity, this polyclonal antibody is an essential tool for studying the functions of ULBP2 and its interaction with other molecules in different biological systems.</p>

<p>JMJD6 antibody was raised in Rabbit using Human JMJD6 as the immunogen</p>

<p>Mouse monoclonal HDHD1 antibody</p>

<p>Rabbit polyclonal JIP1 antibody</p>

<p>Rabbit polyclonal RDBP antibody</p>

<p>The FHL1 antibody is a monoclonal antibody that specifically targets alpha-fetoprotein (AFP) and leukemia inhibitory factor (LIF). This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.</p>

<p>The CDC6 antibody is a cytotoxic hormone peptide that has been shown to have inhibitory effects on antiphospholipid antibodies. It acts as an electrode for interferon and dopamine, and it also functions as a glycoprotein with anticoagulant and antiviral properties. This monoclonal antibody is specifically designed to target human serum autoantibodies, making it highly effective in treating various conditions related to autoimmune disorders. Additionally, the CDC6 antibody has been found to exhibit leukemia inhibitory factor activity, further enhancing its therapeutic potential.</p>

<p>The MIOX antibody is a highly specialized monoclonal antibody that targets the tyrosine kinase receptor. It acts by inhibiting the activity of this receptor, which plays a crucial role in cell growth and division. By blocking the receptor, the MIOX antibody effectively prevents the activation of downstream signaling pathways that promote tumor growth.</p>

<p>STUB1 antibody was raised using the N terminal of STUB1 corresponding to a region with amino acids MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYG</p>

<p>Rabbit polyclonal ECHDC1 antibody</p>

<p>Rabbit polyclonal NPY2R antibody</p>

<p>PUM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MNHDFQALALESRGMGELLPTKKFWEPDDSTKDGQKGIFLGDDEWRETAW</p>

<p>Rabbit polyclonal RAD51AP1 antibody</p>

<p>Rabbit polyclonal PFDN1 antibody</p>

<p>PEX26 antibody was raised using the middle region of PEX26 corresponding to a region with amino acids ELVVGSAAFGEERRLDVLQAIHTARQQQKQEHSGSEEAQKPNLEGSVSHK</p>

<p>HSD11B1 antibody was raised in Rabbit using Human HSD11B1 as the immunogen</p>

<p>Rabbit polyclonal MEF2B antibody</p>

<p>RBM42 antibody was raised using the C terminal of RBM42 corresponding to a region with amino acids DPSDYVRAMREMNGKYVGSRPIKLRKSMWKDRNLDVVRKKQKEKKKLGLR</p>

<p>Rabbit polyclonal POLR2J antibody</p>

<p>Rat monoclonal CD150 antibody (PE)</p>

<p>Rabbit polyclonal eEF2K antibody (Ser366)</p>

<p>CENPA antibody was raised using the middle region of CENPA corresponding to a region with amino acids ALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG</p>

<p>Mouse monoclonal OBFC1 antibody</p>

<p>BRF1 antibody was raised in mouse using recombinant Brf1 Homolog, Subunit Of Rna Polymerase Iii Transcription Initiation Factor Iiib (S. Cerevisiae) (Brf1)</p>

<p>MOV10L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LNVGQEVIAVVEENKVSNGLKAIRVEAVSDKWEDDSRNHGSPSDCGPRVL</p>

<p>PYGL antibody is a polyclonal antibody that is highly reactive and immunogenic. It is designed to target and neutralize autoantibodies, antiviral antibodies, and other harmful substances in the body. PYGL antibody specifically recognizes adenine and circumsporozoite protein, allowing for precise detection and elimination of these targets. The colloidal nature of this antibody ensures a strong antigen-antibody reaction, leading to efficient binding and neutralization of harmful agents. Additionally, PYGL antibody has been shown to enhance the production of growth factors, interferons, and cytotoxic agents, further boosting the body's immune response against pathogens. This versatile antibody is an essential tool in Life Sciences research and diagnostics.</p>

<p>Rabbit polyclonal ARSK antibody</p>

<p>The CORO1A antibody is a highly specialized monoclonal antibody that is activated and designed to target a specific antigen. It is commonly used in the field of Life Sciences for various research purposes. This multispecific antibody is known for its high affinity towards its target and can be used in a variety of applications, including immunohistochemistry, Western blotting, and flow cytometry.</p>

<p>The Synaptophysin antibody is a highly specific monoclonal antibody that targets the carbonic anhydrase enzyme. It is activated in cholinergic neurons and has been widely used in Life Sciences research. This antibody has anticoagulant properties and can neutralize the activity of protein kinase 3-kinase, a growth factor involved in fibrinogen glycation. Its high specificity makes it an essential tool for studying the role of carbonic anhydrase in various biological processes.</p>

<p>Rabbit polyclonal CDKN1B antibody (Thr198)</p>

<p>The RPA2 antibody is a highly specific monoclonal antibody that targets glucagon, a hormone involved in regulating blood sugar levels. This antibody has been extensively studied in the field of life sciences and has shown promising results in various research applications.</p>

<p>ApoBEC1 antibody was raised using the N terminal of APOBEC1 corresponding to a region with amino acids TSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIW</p>

<p>The CD19 antibody is a monoclonal antibody that has neutralizing properties. It is used in immunoassays to detect the presence of specific antibodies in human serum. The CD19 antibody is immobilized on microspheres and can be used as a test substance to determine the presence or absence of certain antibodies. This antibody has been modified with colloidal acid to enhance its stability and improve its binding affinity. Additionally, the CD19 antibody has shown efficacy against Pseudomonas aeruginosa, a common pathogen associated with respiratory infections. Its glycosylation and acid residue modifications contribute to its high specificity and effectiveness in targeting autoantibodies.</p>

<p>Rabbit polyclonal RNF168 antibody</p>

<p>ACAA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD</p>

<p>The HP antibody is a cytotoxic monoclonal antibody that acts as a growth factor inhibitor. It is designed to target specific receptors and block their activity, preventing the growth and proliferation of cells. The HP antibody has been shown to be effective in inhibiting the activity of tyrosine kinase inhibitors such as imatinib. It also has neutralizing properties against extracellular histones, which can contribute to inflammation and tissue damage. This antibody is widely used in the field of Life Sciences for research purposes, particularly in studies involving phosphatases and other signaling pathways. With its potent inhibitory effects and specificity, the HP antibody offers great potential for therapeutic applications in various disease conditions.</p>

<p>Mouse monoclonal PSMC3 antibody</p>

<p>Rabbit polyclonal PPP1R11 antibody</p>

<p>Rabbit polyclonal UBXN4 antibody</p>

<p>ME3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGPARPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQD</p>

<p>SLC25A14 antibody was raised using a synthetic peptide corresponding to a region with amino acids SIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGV</p>

<p>Mouse monoclonal IgM antibody (FITC)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its potency has been demonstrated through a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Rabbit polyclonal CLDN8 antibody</p>

<p>Rabbit polyclonal PDIA3 antibody (biotin)</p>

<p>Rabbit polyclonal H3F3B antibody (Ser31)</p>

<p>Rabbit polyclonal ZBTB7B antibody</p>

<p>Mouse monoclonal PNMA3 antibody</p>

<p>The TRIM14 antibody is a highly effective antiviral agent that belongs to the class of monoclonal antibodies. It acts as an inhibitor of protein kinase and growth factor signaling pathways, preventing viral replication and spread. This antibody also has metal-binding properties, which contribute to its neutralizing activity against viruses. In addition, it enhances the activity of phosphatases and interferon, further boosting the immune response against viral infections. The TRIM14 antibody is available in both monoclonal and polyclonal forms, offering a wide range of options for researchers in the field of Life Sciences. Its high specificity ensures minimal cross-reactivity with other proteins, making it a valuable tool for studying virus-host interactions. With its ability to induce lysis of infected cells and neutralize viruses in human serum, this antibody holds great promise in the development of antiviral therapies.</p>